CAZyme Information: MGYG000001688_00326

Basic Information

• Species: Hungatella_A hathewayi_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella_A; Hungatella_A hathewayi_A
• CAZyme ID: MGYG000001688_00326
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
865	MGYG000001688_1|CGC5	99506.06	4.7939

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001688	5654180	Isolate	not provided	not provided

• Gene Location: Start: 333014; End: 335611 Strand: +

Full Sequence      

MDKIQSLNGIWNLQKGNDTASRIPAAVPGTVLSAMLKHGAIEDPFWRCNEYRTREFMASD
FTYDREFTVESLDCDSVTLVCEGLDTLATVAVNGVEIARTDDMHRTYRIEVKKFLRAGVN
HISIRFDSALVAARKEDAENDIFYASTGCIHGNAAIRKAHYMFGWDWGPQLPDAGIFRNI
SLEYRSLPKFADVLIKQEHGGDGSVALKLYTEVDFLAEKRNLSVSMSPESKWTETELSLA
VTIEDPDGNCMAEIYPFQREISMEIPNPRLWWPNGVGEHPLYQVSVELKTGDGVVCDICR
KRIGLRTIDVCTDAHEYGSEFAFVVNGVKIFAMGANYIPEDILLSRVTKERTCRLVKDCE
SANYNCIRVWGGGYYPDDYFYDACDEAGIMVWQDLMFACNVYALTEHFEENIVEETKDNV
RRLRHHPCLALWCGNNEMEWGWGDEWARIKGHHPRYKADYIKIFEYILPKALKNCDDVTF
YWPSSPSSGGSLDDPNAVNRGDQHYWEVWHSGKPFTEYRKEYFSFCSEYGFQSFPGMKTI
ESFTLLEDRNIFSQVMESHQKNGSANGKILNYVADYFLYPKSLGDLAYISQVLQLKAIQY
GVEHWRRNRGRCMGSLYWQINDCWPVASWASIDYFGRWKALHYGAKRFYAPVMVSACEKE
ELSSEIGYFVNNDTLEPVQGRVEAALIDQDFQVLWEHTEDITVEPMSVGQSFSVDYRSVA
PKRMEERKEEQQAERHAKQQETWDEEKSCFFARVRLYIGDTPVSEQVTLFVKPKHFQYRK
PEYVIAVTETEEQFIIRVRSSSFAQYVELELEELDGVFSDNYFDITTPEGVEVSLPKTEL
PEGCTLKNLERQIRVRSVADSYEVG

Enzyme Prediction     

No EC number prediction in MGYG000001688_00326.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	778	5.8e-112	0.7486702127659575

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	8.32e-102	1	741	9	719	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	1.70e-18	780	860	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	1.51e-13	63	441	113	453	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	1.20e-12	669	775	6	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10150	PRK10150	1.06e-07	174	310	168	280	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET87559.1	0.0	1	863	1	837
QRV20341.1	0.0	1	862	1	845
ADL05496.1	0.0	1	862	1	845
QQO08489.1	0.0	1	862	1	828
QOV18719.1	0.0	6	862	6	826

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OP6_A	1.69e-152	3	864	9	842	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2VJX_A	2.18e-152	3	863	7	839	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.31e-152	3	863	9	841	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	4.43e-152	3	864	7	840	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	2.57e-150	3	863	7	839	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CGA8	1.92e-109	15	683	21	697	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
B8NW36	1.42e-107	11	654	13	658	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
Q2TXB7	1.42e-107	11	654	13	658	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
Q5B7W2	2.71e-107	27	687	32	701	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q0CCA0	1.02e-106	5	654	7	656	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001688_00326.