CAZyme Information: MGYG000001675_01418

Basic Information

• Species: UBA1685 sp900546845
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-138; UBA1685; UBA1685 sp900546845
• CAZyme ID: MGYG000001675_01418
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1249	MGYG000001675_47|CGC1	138308.71	5.5797

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001675	2267050	MAG	United States	North America

• Gene Location: Start: 977; End: 4726 Strand: +

Full Sequence      

MRQKALILLAGLLAILLACAPMALAEASENLAANGGFETLAESSELPEGWFYEAWDEDPS
MGYAMRSEDEGGTAYLWSAGNDVRLCQTVAVEAGSYYKLACRVRTEGVEGGAGANLSVAG
SLAASEGVYGTGAWQTVELIGKTGDEQTELTICVRIGGYGAEAAGGAWFDDVSVTHLTDF
AGDAADFSTAAAPSEPEAEYVDGEIPYLAECCAALFFSACLMFFFYSRFIVRADTLGRPA
ARDRLALGCILISAFFVRALLSILIYGHPTDISCFMAWSNALANDGLKSFYTSGMFADYP
PGYMYVLWLTGSIAKALRLTYGSAGYVLLTKMPAILADLGAAYLLYRLAAKPRASLEKAA
GNGVLPLVLAAVVAFNPLFAFISGGWGQIDQVLTLLLIAVIFLFLNKKVILAGLVYGIAI
LVKPQALMAGPLLAVAYFAYVKDAGWKGLLRTLAAVASAVAVLFVLSLPFRGGQETLWFL
EKILGTATSYPYASVEAFNLFALLGGNWANADQTLVLFSYKTWGTIFICLSVVFSAFLYL
KGRKREPHALTLALAFCLAALFMFGQYMHERYLFPALLLLLIAFTAYRDRRIFVSFAWLC
CSLLFNCLMAIIIVDHQEARGMTYDLVTAIGSLLNLGGFAYLAYTCCDILLCRRKHPAFC
EKAPERPAPPEALPDPVDNTLHYSKRDKLYCIALTAVYAAVALVNLGTTTAPETAWYGHA
GDEVRIMLDQTAEIAEIRVFGGLYTGSILLVADDGTEYEYTEENGHMFRWKDIANGASAT
TAGFTLSVTSGKVWFNEFAFFDAEGNYIPAEAEGEAALLFDEPEEVPETPSYLNGMYFDE
LYHARTAYEHLHGLSPYENSHPPLGKVFIMLGIAIFGMNAFGWRIIGTLFGIGMVPVLYA
FAKRLFKKSEYALLTALLFAFDFMHFTQTRIATIDVYGVFFILLMYYYMYQYYTMNFFSD
GLKKTLKPLALAGVFFGLGAASKWICFYAGAGLAVIFFTSLVQRYLEYRRFRRSEDAALR
EAVEPFWRNAFNSCLWCVAFYILIPAAIYLLSYLPYVLSEDHYGIREIWGVQEFMFSYHS
GLTATHSYQSPWWQWPLLIRPMWYYVGYDVAPGNISTMSAMGNPAVWWVCSAVTAGVIYS
LLRGKRRGDKTLFVLLVGLGANYLPWVLVSRCTFIYHFFASVPFILLITVYALQKKEERD
KRYAKLKWIWMAAALALFALFYPVISGAECARTYVTFLEWLPSWTFMGV

Enzyme Prediction     

No EC number prediction in MGYG000001675_01418.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	833	1056	6.7e-55	0.9192825112107623

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	1.11e-21	1069	1194	4	141	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG5542	COG5542	3.90e-18	286	595	83	371	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].
COG1928	PMT1	4.60e-16	832	1053	62	264	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	4.64e-16	1072	1246	505	695	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	2.81e-14	831	1055	16	239	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT55655.1	1.38e-247	1	1246	1	1253
QGQ95357.1	2.29e-245	27	1246	35	1279
QWU18200.1	1.31e-234	27	1246	29	1273
ASA25569.1	8.84e-234	1	1246	5	1268
AIQ11159.1	4.34e-232	27	1246	29	1273

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_B	1.25e-06	1093	1244	581	751	Structureof S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	6.67e-30	838	1244	67	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	2.35e-28	838	1244	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	2.35e-28	838	1244	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
P31382	6.84e-06	1093	1244	581	751	Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000525	0.578080	0.420639	0.000266	0.000243	0.000213

TMHMM  Annotations     

start	end
5	27
213	232
245	267
324	346
359	381
385	404
411	433
448	470
483	505
520	542
549	568
572	587
592	614
629	651
689	711
880	902
931	953
968	1002
1035	1057
1125	1144
1151	1169
1174	1193
1206	1228