CAZyme Information: MGYG000001673_00682

Basic Information

• Species: UMGS1537 sp900552695
• Lineage: Bacteria; Firmicutes_A; Clostridia; UBA1212; UBA1255; UMGS1537; UMGS1537 sp900552695
• CAZyme ID: MGYG000001673_00682
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482	MGYG000001673_7|CGC2	55296.97	6.073

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001673	2567696	MAG	United States	North America

• Gene Location: Start: 58525; End: 59973 Strand: -

Full Sequence      

MKILFVSAEVQPFIKTGGLADVSFALPKALREKGEDIRIILPKYGDISLNYTSKANLIAS
FGVSVGWRNQYCGLEYLNYDGIPVYFIDNEYYFKRPGCYGHFDDGERFAFFCRAVLESVK
YMDSFHPDIIHCNDWQTGIIPVFLKDVYYDRPEFSHTRSVFTIHNLKYQGVFSPSVLEEL
LGLSPQYNAEDKLKFHDGISFMKGGIVFSDRITTVSETYAKEIQTQYYGENLDGLLRQKS
YKLRGITNGIDYGNNHPKTDKNILLNYTFRSIQRKAANKLDLQKAAGLPENPEVPVLSMI
TRLVRQKGIDLVTRVMEEILKMDIQFVLLGTGDQDYQDFFEYYASSYPGKISAFIKFDGV
LASKIYAGSDLFLMPSLFEPCGLSQMIAMAYGTLPIVRETGGLRDTVIPYNEFTGEGNGF
SFTNYNAHDMLHVIEYAVTQYRNKETWRNLMKNAMRTKYDWNTQSEEYLKLYREISEGSI
DQ

Enzyme Prediction     

EC	2.4.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	473	6.7e-187	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0297	GlgA	0.0	1	475	1	478	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	1	475	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	1	475	1	463	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	474	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14099	PRK14099	3.97e-127	1	475	4	479	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYD40168.1	1.10e-210	2	476	3	477
AKN29537.1	2.21e-210	1	476	2	477
AKA69796.1	3.25e-210	1	476	2	477
AWI04094.1	5.94e-208	1	476	2	477
QAT39442.1	1.89e-206	1	475	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	1.30e-90	1	472	1	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	9.02e-90	1	472	1	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	7.04e-89	1	472	1	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
6GNE_A	1.89e-84	1	472	10	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
4HLN_A	3.85e-84	2	472	126	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q97GX6	4.94e-203	1	475	1	476	Glycogen synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=glgA PE=3 SV=1
A0PY73	6.38e-192	1	475	1	475	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1
B2V049	2.69e-188	1	476	1	476	Glycogen synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=glgA PE=3 SV=1
B2TR28	2.19e-187	1	476	1	476	Glycogen synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=glgA PE=3 SV=1
A4XHL5	3.00e-187	1	475	1	475	Glycogen synthase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) OX=351627 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001673_00682.