CAZyme Information: MGYG000001666_01663

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000001666_01663
• CAZy Family: GH171
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000001666_109|CGC1	44139.68	6.1136

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001666	2832137	MAG	United States	North America

• Gene Location: Start: 2821; End: 4020 Strand: -

Full Sequence      

MKKYLMSGILLFAFLGLLIAGCGVASASEGAEEVIVGAAQTDEYLPLLKGKRVALFSNHT
GMVGDRHTIDVMRDAGINVVTIFSPEHGFRGNADAGEHVSSSVDSKTGVPIVSLYGSKAQ
RTPSKEVMDGIDVIVTDIQDVGLRFYTYYCTMVDLMNAAAQHGKEFVVFDRPNPNGMYVD
GPILDMKYESGVGRLPITVVHGMTLGEIARMANGEGWLKDGEKVPLTVIPVKNYTHQTRY
ALPVAPSPNLKDMKAIYLYPSICYFEATPVSLGRGTSWPFEIYGHPGMKNRAFSFTPRSV
DGAKNPPQLDKKCYGVDLRGLDDEKIIAEGINLEYLIDAYRDLGMGDKFFRSFFELLIGR
GDIRKMIEDGYSAEEIKATWAPDVARFKEQRRPYLIYPE

Enzyme Prediction     

No EC number prediction in MGYG000001666_01663.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH171	53	397	5.9e-111	0.9971830985915493

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07075	DUF1343	1.15e-167	54	397	1	362	Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
COG3876	YbbC	1.73e-89	1	397	1	409	Uncharacterized conserved protein YbbC, DUF1343 family [Function unknown].
cd21002	IgC1_MHC_II_beta_HLA-DM	0.006	217	248	38	75	Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain of histocompatibility antigen (HLA) DM; member of the C1-set of Ig superfamily (IgSF) domains. The members here are composed of the Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain of histocompatibility antigen (HLA) DM. Human HLA-DM plays a critical role in antigen presentation to CD4 T cells by catalyzing the exchange of peptides bound to MHC class II molecules. Type 1 diabetes is correlated with DM activation and it is also implicated in viral infections such as herpes simplex virus, celiac disease, multiple sclerosis, other autoimmune diseases, and leukemia. MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. These molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), including B-lymphocytes, monocytes, and macrophages in both humans and mice. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from proteolytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosome before they are transported to the cell surface. MHC class II molecules are heterodimers, comprised of two similarly-sized membrane-spanning chains, alpha and beta. Each chain had two globular domains (N- and C-terminal), and a membrane-anchoring transmembrane segment. The two chains form a compact four-domain structure. The peptide-binding site is a cleft in the structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ31137.1	2.61e-185	22	399	12	388
QCQ44443.1	2.61e-185	22	399	12	388
QLK81838.1	2.61e-185	22	399	12	388
QRM69467.1	2.61e-185	22	399	12	388
QCQ35550.1	2.61e-185	22	399	12	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JJA_A	6.84e-173	33	399	5	370	Crystalstructure of a DUF1343 family protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution [Bacteroides fragilis NCTC 9343]
4K05_A	9.82e-45	48	397	28	398	Crystalstructure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343],4K05_B Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40407	7.66e-70	43	397	47	414	Uncharacterized protein YbbC OS=Bacillus subtilis (strain 168) OX=224308 GN=ybbC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000120	0.100812	0.898962	0.000049	0.000053	0.000040

TMHMM  Annotations     

start	end
5	27