CAZyme Information: MGYG000001664_02320

Basic Information

• Species: CAG-485 sp900760735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900760735
• CAZyme ID: MGYG000001664_02320
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
861	MGYG000001664_66|CGC1	97716.75	6.1366

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001664	3152185	MAG	United States	North America

• Gene Location: Start: 12983; End: 15568 Strand: +

Full Sequence      

MRKLKMGLLISAMMVAVAAVGAEKFISFNTQKGYYPLIENGKPAAVYIDQKVDSAVIIAA
ENLSKDFQAVCGERARISRNADSSTGIIVTTVGSPVADLLIKNKTIAGNDIAGKREKFLI
TSVKRPCENVDSAVVIVGSDRRGTVYGIYELSEQLGVSPWYWWADVPVEHNSTACFKPGS
YTDGEPAVAYRGIFLNDEAPSLTSWVKNHYGTDYGDHRFYADVFELILRLRGNFMWPAMW
GWAFYADDAQNSATADRMGVIMGTSHHEPMVRNHQEWARNRQKYGAWNYSTNQAVIDDFF
RQGVRRMKGTEDIVTIGMRGDGDEAMEEGTNVKLMERIIRNQRDIIAKETGRPAKETPQV
WALYKEVLDYYDAGMKVPDDVIMLLCDDNWGNVRRLPNEKERKHPGGWGMYYHVDYVGAP
RNTKWLNVTPIQGMWEQLALTYDYGVDKLWILNVGDLKPMEYPISLFMDMAWNPHRYDQN
TLMEHVKKYCTSAFGEEHGEEAARILNAYCKLAGLVTPEMLDKDTYDLESDEWRMISDRW
ARLEAEALRQYVALPEQYRDAYQQLILFPVQAFGNLYEMYYAQAMNHSLAKNNDPAANDW
ARKVERCFNRDAELCRNYNKTIAGGKWDGMMSQKHIGYTSWNDDFKQDTMPEVVTVNAGD
RNAGGYTVNADGNTAVIEAEHFYSAKTPEEMQWTVYPDMGRTLSGVALTPYTRKPKDASL
TYRIKLPERADSVTVRFVVKSTLAFSNPEGHCFSAGFDGAPSVTVNINHDLNERPENIYT
VFYPTVASRVIEKQIKLLVTYTPDGYALLTLTPHDPAIVFEKIIVSAGDYKPTYLHLPES
PVVRTLLVESTEHRRGPRKKL

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	35	823	4.3e-274	0.994261119081779

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	184	520	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	2.92e-26	677	839	11	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	2.46e-04	26	151	8	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT78586.1	0.0	15	840	13	838
QDM11119.1	0.0	15	840	13	838
ALJ48348.1	0.0	15	840	13	838
EDO10816.1	0.0	15	840	24	849
SCV07757.1	0.0	15	840	24	849

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	15	840	24	849	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	0.0	35	841	17	835	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	0.0	35	841	16	834	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	2.85e-173	21	663	1	640	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	1.07e-125	44	657	20	662	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.147716	0.828209	0.023003	0.000438	0.000286	0.000327

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001664_02320.