CAZyme Information: MGYG000001663_00021

Basic Information

• Species: Alistipes sp900760675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900760675
• CAZyme ID: MGYG000001663_00021
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777	MGYG000001663_1|CGC1	84128.92	5.1648

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001663	3090424	MAG	United States	North America

• Gene Location: Start: 22389; End: 24722 Strand: -

Full Sequence      

MFSISEGTGVFSRCRAQKTKEEKPTITDAMMKYCKIIAGCLLLLSSSCGQQPAGKDAAVE
RKVEALLSRMTLQEKIGQMNQLSPFGGTDELAATIKEGKVGSLLNITDPAAVNRAQRIAV
EESRLGIPLVIARDVIHGYKTIFPIPLGQAATFNPQMVRDGARVAAVEASADGIRWTFAP
MIDISRDPRWGRIAESFGEDPCLSSVMGVAMVQGFQGDSLDDPTSMAACAKHFVGYGAVE
AGRDYNSTFLPERLLRNVYFPPFEAAANAGCATFMTSFNDNDGIPATANSFLLKDVLRKE
WNYDGVVVTDWASATEMIAHGFCTDARDVAEKSVNAGVDMDMVSGSFVANLEELVRQRKV
DVSTIDDAVRNILRLKFRLGLFDNPYVEADKSVQYAPEHLAKAREAAAQSVILLKNDNGV
LPLGENIRTIAVVGPLADAPYDQMGTWVFDGEKAHTQTPLKALQQIYGDKMRIIYEPGTA
YSRDKRTEGIARAAAAAARADVVLAFVGEESILSGEAHSLAGLDLQGAQSELIEALARTG
KPLVTVVMAGRPLTIGREADRSSALLYSFHPGTMGGPALADILFGKVNPSGKTPVTFPKM
VGQVPVYYAHNQTGRPPSRKETLIDDIELEAGQTSTGCTSFYLDAGFDPLYPFGYGLSYT
AFAYDEISLGANKIKSDGVLKASVYITNVGKRAGEEVVQLYVQDKVGSVTRPVKELKAFR
RVALEPGEGRTVSFEVPVGELAFWNIEMKRVVEPGEFRLWLGTSSAEGLWADFEVVK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	121	343	6.8e-72	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	30	774	1	763	beta-glucosidase BglX.
COG1472	BglX	2.26e-111	70	469	1	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	6.39e-92	71	375	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	6.65e-84	59	762	49	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	8.83e-54	411	659	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69450.1	0.0	31	776	1	749
ALJ43896.1	0.0	31	776	1	748
QQA09220.1	0.0	31	776	1	748
ALJ61573.1	0.0	31	776	1	749
QUT92858.1	0.0	31	776	1	749

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	8.50e-203	59	767	10	743	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	4.80e-202	59	767	10	743	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	3.71e-196	60	765	10	740	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	5.44e-179	60	767	4	724	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	1.04e-178	45	767	19	756	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	1.61e-192	52	776	31	765	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	3.62e-188	52	776	31	765	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	1.87e-128	36	765	10	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A7LXU3	1.27e-124	56	762	32	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
T2KMH9	1.32e-117	59	777	36	756	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.061020	0.405613	0.533148	0.000036	0.000149	0.000041

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001663_00021.