CAZyme Information: MGYG000001661_01542

Basic Information

• Species: Bacteroides gallinarum
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides gallinarum
• CAZyme ID: MGYG000001661_01542
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
824	MGYG000001661_11|CGC1	94300.81	8.6329

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001661	3951783	MAG	United States	North America

• Gene Location: Start: 67748; End: 70222 Strand: -

Full Sequence      

MKKFLLSFCLSVISLAVFSAEQFTLFKQSAGCFPLVADGRPCPIKIDANEEQGVKMAIEN
LQQDILEVCGTKPETNPRTVGRHCILIGTYHSPLIQHLFSSGKLNKAELEGKREKYILQT
VSSPCKGIDKALIIAGSDKRGTIYGIYELSKQIGVSPWYWWADVPVHKHTNIYIKPGIYT
DGEPKVEYRGIFINDEWPCLGNWAKEKFGGFNSKFYKHVFELVLRLKGNFMWPAMWGSAF
YDDDPQNGVLANTMGIVMGTSHHEPMALAQQDWKRRGKGVWDYTQNKKGLNDFWTYGIER
SKNWESVITIGMRGDGDEPMSESANIALLENIVKDQRAIIEKVTGKKAGKTPQVWALYKE
VQDYYDKGMRVPDDVTLLLCDDNWGNVRKLPRPDEKPRTGGYGMYYHFDYVGAPRNSKWI
NINPIPRIWEQMHLTYEYGVRKLWIVNVGDLKPMEYPITFFLDMAWNPDRFNAQNLQQHT
EEFCARQFGSTYAKEAARILSLYAKYNRRVTPEMLNAKTYSFNYGEWERVVNEYNALALD
AHNLGFLLPPAYRDAYDQLISFPVQACSNLYNMYYAQAKNQALAAKKDPEANYWADKVIS
CFQRDSILTDYYHKTISDGKWNHLMSQIHIGYTSWNNPKKQTMPKITRVPERSVPYTFKE
VKGYVSIEAEHFTRAVSEGRTTWNIIPGFGKTLSGITTSPVTKTPEKMYLEYDIEIEKTG
NVRVELLLAPTLNFNENKGLSYAVSFDGGEEQIINFNGHYTGELGKWQSNPIIESRSIHR
LDKKGMHTLRIRPLNPGIVIEKILIHAGGLKPSYLGAPETLTRL

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	31	803	2.3e-290	0.9971305595408895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	182	514	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	2.84e-56	657	819	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.002	49	149	28	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).
cd04080	CBM6_cellulase-like	0.007	709	791	58	129	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93956.1	0.0	1	823	1	823
QDO71564.1	0.0	12	823	1	816
EDV05080.1	0.0	12	823	32	847
QUT92919.1	0.0	8	823	10	831
ALJ61511.1	0.0	8	823	10	831

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	1	823	12	852	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	2.97e-285	33	820	17	834	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	2.14e-282	33	820	16	833	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	2.93e-223	26	816	8	929	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	2.67e-154	53	820	31	963	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000339	0.999020	0.000153	0.000161	0.000144	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001661_01542.