CAZyme Information: MGYG000001661_00833

Basic Information

• Species: Bacteroides gallinarum
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides gallinarum
• CAZyme ID: MGYG000001661_00833
• CAZy Family: GH28
• CAZyme Description: Exo-poly-alpha-D-galacturonosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533	MGYG000001661_5|CGC1	58468.68	6.0806

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001661	3951783	MAG	United States	North America

• Gene Location: Start: 94512; End: 96113 Strand: -

Full Sequence      

MNTLSKKLFTLTALFLALLPARNTACAQCKSPVDENIYKELPFSMPEVEQPSFPDYTVNI
LDFGAKSDGITLNTRAINDAIKAVNAKGGGKVVIPAGWWLTGPIELLSNVNLYTEKNALV
VFTDDFNAYPIIETSFEGLNTRRCQSPISARNAENIAITGYGVFDGSGDSWRPVKQGKLT
PTQWDNLVKSGGVVDNSIWYPTEGSLKGARACKNFNNPEGIETDEEWNEIRPWLRPVLLS
IVKSKRVLLEGVTFKNSPSWCLHPLSCEHITINRVKVFNPWYSQNGDALDLESCKNALVI
NNIFDAGDDAICIKSGKDEDGRKRGEPCQNVIVKNNTVLHGHGGFVVGSEMSGGVKNIYV
TDCTFLGTDVGLRFKSTRGRGGVVEGIYIHNIHMLDIPHEPLLFDLFYGGKGAGEETEEE
LKGRMKTAIPPVTVETPSFRDIHISNVICKGSGRAMFFNGLPEMPIKNVTVKDVIISDAK
EGVVISQAEGVTLENIRIDTQGHTLDVKNAKELKVDGKVYSTIGAEGKLLDFK

Enzyme Prediction     

No EC number prediction in MGYG000001661_00833.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	84	496	1.7e-83	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	1.56e-86	53	527	78	542	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	7.15e-19	185	511	54	316	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02218	PLN02218	3.54e-18	57	480	67	412	polygalacturonase ADPG
PLN03003	PLN03003	3.48e-15	58	517	24	385	Probable polygalacturonase At3g15720
PLN03010	PLN03010	8.70e-14	59	419	48	331	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT45779.1	0.0	1	533	1	533
QRQ48628.1	0.0	1	533	1	533
AVM53658.1	0.0	1	532	1	532
AVM57477.1	0.0	1	532	1	532
QDO69196.1	0.0	1	526	1	528

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	1.23e-69	48	496	18	429	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	2.38e-65	38	496	21	446	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	3.38e-36	44	518	143	604	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
1BHE_A	2.48e-17	48	411	6	317	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
4MXN_A	8.58e-15	55	166	21	121	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	5.34e-40	56	476	61	424	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P15922	9.29e-34	58	518	152	598	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P27644	5.80e-27	239	465	25	249	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
P18192	1.17e-18	82	411	57	343	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1
Q8RY29	1.50e-18	57	480	67	412	Polygalacturonase ADPG2 OS=Arabidopsis thaliana OX=3702 GN=ADPG2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002510	0.782438	0.214155	0.000408	0.000245	0.000228

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001661_00833.