CAZyme Information: MGYG000001661_00173

Basic Information

• Species: Bacteroides gallinarum
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides gallinarum
• CAZyme ID: MGYG000001661_00173
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
778	MGYG000001661_1|CGC6	85134.51	7.4042

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001661	3951783	MAG	United States	North America

• Gene Location: Start: 233553; End: 235889 Strand: +

Full Sequence      

MKKFLKRTSMLLATALVVGIAPVQAQQPPQDIDRFVSALMKRMTVEEKIGQLNLPVTGEI
TTGQAKSSDVAKKIEQGLVGGLFNLKGVDKIRDVQKLAVENSRLGIPLLFGMDVIHGYET
IFPIPLGLSCTWNMAAIQESARIAAVEASADGISWTFSPMVDISRDPRWGRVSEGSGEDP
FLGGAIAKAMVYGYQGADPSKQLKRSDEILACVKHFALYGAGEAGRDYNTVDMSRNRMFN
EYMYPYEAAVQAGVGSVMASFNEIDGVPATANKWLMTDVLRKQWGFNGFVVTDFTGISEM
VEHGIGNLQTVSARALNAGVDMDMVSEGFVGTLKKSVMEGKVSMKTLDTACRRILEAKYK
LGLFDNPYKYCDPERPARDIFTKEHRAAARRIAAESFVLLKNDGMKQHPGSLPQPLLPLK
KQGTVAVIGPLGNTRSNMPGTWSVAARLDDYPSLYEGLKEMMSGKVNITYAKGSNLIGDA
AYEERATMFGRSLNRDNRTDKELLDEALKAAAGADVIVAALGESSEMSGESSSRTDLGLP
DVQRTLLEALLKTGKPVVLVLFTGRPLTLTWEQANVPAILNVWFGGSEAAYAIGDVLFGD
VNPSGKLTMTFPKNVGQIPLFYNHKNTGRPLQEGKWFEKFRSNYLDVDNDPLYPFGYGLS
YTTFQYSDIALSAPTMGQDGSVTAAITVTNTGKRDGAEVVQLYIRDLVGSITRPVRELKG
FEKIFLRAGESKTVSFKITPELLRFYDYDLNHVAEPGEFDLFIGGNSRATKTARITLK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	100	325	8.6e-71	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	10	777	3	764	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	1.36e-120	44	357	1	316	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	3.57e-98	43	460	1	385	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.87e-69	120	764	112	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	2.23e-59	398	661	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ49061.1	0.0	1	778	1	777
QUT61921.1	0.0	1	778	1	778
QQA31820.1	0.0	1	778	1	778
QMI79576.1	0.0	1	778	1	778
BBK86043.1	0.0	1	778	3	780

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	0.0	25	778	3	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	0.0	25	778	3	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	0.0	29	778	6	751	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	1.41e-235	31	777	2	732	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	4.15e-235	28	777	31	764	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	4.17e-232	18	777	7	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	5.90e-232	18	777	7	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	4.85e-141	89	778	48	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A7LXU3	2.32e-115	32	764	35	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
T2KMH9	1.83e-112	32	778	36	755	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000323	0.998932	0.000246	0.000173	0.000166	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001661_00173.