CAZyme Information: MGYG000001657_00041

Basic Information

• Species: RC9 sp900760425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900760425
• CAZyme ID: MGYG000001657_00041
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748	MGYG000001657_2|CGC1	81945.98	4.8008

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001657	2980281	MAG	United States	North America

• Gene Location: Start: 10591; End: 12837 Strand: -

Full Sequence      

MTVVACGHAGSESGKDSEMDAFINDLMARMTLEEKVGQLNLPAGGDIVSGQVFGTDLSEL
IASGRAGGFFNVKGVEKITEFQMLAVEKSRLGIPLLVGADVIHGYETMFPIPLALSCSWN
PSAIERMARISAIEASADGVNWTFSPMVDICRDARWGRIAEGSGEDPWLGSLMAAAYVRG
YQGTDMSCDNEIMACVKHFAAYGAPEAGRDYTAVDMSLQKLYNCYLPPYRAAVEAGAGSV
MTSFNLLNGEHPTASRWLLDGLLRRQWGFNGMVVTDYNSISDMATLGLAEAPEAAAMSLK
AGTDMDMVSGAYLNTLGDSYRKGLISMEEIDRACRRVLEAKYRLGLFSDPYKYCRPQRAE
TELYTEAHLKAAREIASETFVLLKNDNSILPLQKKGKIALVGPLADAGNNMCGMWSQLCV
DSRHISLLQAFKEELGKDAELLYAQGSNLYYSEKTQQYATGRRTIPRGDDSSLLREALDV
AARADVIVAALGESCEMSGESASRSDITIPDAQRHLLERLVATGKPVVLLLFTGRPLVLD
WESGNVPAILNVWYAGSEAGHAISDAVFGRTTPCGRLTTTFPRAVGQEPLYYNYLQCSRP
PWTDDHFIAYNSNYIDVANTPLYPFGFGLSYTTFEYGNTEFSSDRISAGEPVKISLTVTN
TGNRAGVEIVQLYIHDCIASLARPVKELKDYRRVTLQPGESKKVEFTLTSDDLKFYNSDL
EWVYEPGDFEIMIGPDSGHLNVKRIKGV

Enzyme Prediction     

No EC number prediction in MGYG000001657_00041.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	87	308	3.8e-71	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	20	737	35	754	beta-glucosidase BglX.
COG1472	BglX	6.18e-107	30	435	1	391	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.26e-97	31	340	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	1.45e-66	76	734	64	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.48e-62	381	631	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL40205.1	0.0	1	746	14	757
QNL38257.1	0.0	11	746	22	757
QUT79944.1	0.0	1	746	14	757
QUT26012.1	0.0	1	746	14	757
QRM99933.1	0.0	1	746	14	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	1.93e-288	18	744	9	748	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.10e-287	18	744	9	748	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	4.55e-267	11	743	1	751	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	3.12e-221	17	737	1	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	8.98e-221	7	737	25	754	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	3.58e-206	20	740	35	757	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.30e-203	20	740	35	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	5.28e-138	2	745	16	718	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A7LXU3	7.94e-109	16	734	32	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
T2KMH9	8.40e-107	23	737	40	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000033	0.000003	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001657_00041.