CAZyme Information: MGYG000001655_00134

Basic Information

• Species: Butyricimonas faecalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas faecalis
• CAZyme ID: MGYG000001655_00134
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438	MGYG000001655_1|CGC1	49990.39	9.4025

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001655	4030245	MAG	United States	North America

• Gene Location: Start: 150384; End: 151700 Strand: +

Full Sequence      

MHSLTDRDTAVKKILIITYYWPPAGGPGVQRWLKFSKYLPEFGYDPIIITVDPEKAEYPI
KDHTLEQDVRVGQNVYRTNCSGLYEYYKKLTKTQSAPYSGFVNEGVPSLKQKIARFIRGN
FFLPDARRGWNKHAYRQAVQIIQKEKIDAVITTGPPMSTHLVGQKLKKRFHLHWIADFRD
PWTDIYYYNKMYPTLIAKAIDRKYERNVLLNADQVITVSDYIKKQLAAKSSAIQASKINV
IANGFDAEDFDITIPKEDVFTITYTGTLAADYTIDSFIHSVKRLSISRKFKLRFVGKVDQ
GIAQKLLEELEDFVEIHSFVAHAEAIKYMKSSSVLLLIIPNIEGNKGNLTGKLFEYIGSR
TPILCLGPTDGDAAAIIQVCKAGKTFKYDDEEGMFHFLTSLLDNFNPQSPVKENDAVHRY
SRKSLTRSLTQILAHHED

Enzyme Prediction     

No EC number prediction in MGYG000001655_00134.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	3.98e-47	13	404	1	362	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
COG0438	RfaB	4.36e-16	101	433	40	374	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	1.08e-15	13	404	1	333	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam13439	Glyco_transf_4	3.28e-10	117	248	43	169	Glycosyltransferase Family 4.
cd03809	GT4_MtfB-like	6.34e-09	107	429	46	360	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS30636.1	0.0	1	438	1	438
QRO50372.1	7.85e-297	11	438	1	428
BBE18057.1	1.52e-142	11	433	1	422
QCR22993.1	2.97e-128	14	433	9	435
AMM52951.1	1.37e-127	17	433	1	423

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001655_00134.