CAZyme Information: MGYG000001647_00679

Basic Information

• Species: UMGS1781 sp900553695
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1781; UMGS1781 sp900553695
• CAZyme ID: MGYG000001647_00679
• CAZy Family: GH94
• CAZyme Description: Cyclic beta-(1,2)-glucan synthase NdvB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527	MGYG000001647_14|CGC1	60796.93	5.8173

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001647	1184465	MAG	United States	North America

• Gene Location: Start: 10320; End: 11903 Strand: +

Full Sequence      

MLNAKDMAYKYSKISNAKEELNRVKRYWYELLTRVQVKTPLESMNILLNGWAIYQTIVSR
LWARTGYYQSGGAVGFRDQLQDTLGVKYIDAELMKNQILTQAKHQFIEGDVEHWWHEETN
RGIRTRFSDDLLWLCYVTSEYIEYTGDKSLLDIEIPYLQGELLEDGVDERYDLYLESKEK
GSLYEHCIKAIEKSLNFGENGLPKIGSGDWNDGMNTVGNKKRGESVWLGFFLYEVLNRFI
PICEEVSDNERAKKYIEIRDNLKKALNTNGWDGRWFKRAFTDDGEPIGSIENEECRIDSI
SQSWGVISGAADNDKKYISMESLENHLIDKENGIIKLLDPPFNKTKIEPGYIKAYLPGVR
ENGGQYTHAAMWAIIAFTKLGFGDKGLEYYRMINPIEHSRTKETALKYKVEPFVIPADIY
GAGNLAGRGGWTWYTGSSSWFYKAGLENILGLDIKNKVLRINPCIPKDWKEYSIRYRYKN
SIYNINVKNYNGKNTGVENVYLNGRKVPEKEIILNGDGGIYEVEIEM

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	3	524	4.6e-223	0.48841698841698844

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	0.0	4	526	541	1051	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	1.97e-143	27	452	1	424	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
COG1554	ATH1	0.005	451	524	697	770	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADD03073.1	4.22e-206	10	527	2369	2886
ADH61505.1	4.22e-206	10	527	2369	2886
AEM79409.1	4.24e-206	5	527	2365	2887
AIS53008.1	2.07e-205	10	527	2369	2886
ADV79124.1	2.63e-204	5	527	2364	2886

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QDE_A	3.89e-74	13	527	296	810	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
1V7V_A	1.75e-68	11	507	280	781	Crystalstructure of Vibrio proteolyticus chitobiose phosphorylase [Vibrio proteolyticus],1V7W_A Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc [Vibrio proteolyticus],1V7X_A Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc and sulfate [Vibrio proteolyticus]
3S4C_A	5.26e-56	24	489	311	785	Lactosephosphorylase in complex with sulfate [Cellulomonas uda],3S4D_A Lactose phosphorylase in a ternary complex with cellobiose and sulfate [Cellulomonas uda]
3AFJ_A	1.17e-55	21	508	328	828	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127],3AFJ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127]
2CQS_A	2.20e-55	21	508	328	828	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20471	4.59e-139	21	487	2338	2805	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
B9K7M6	2.17e-78	4	527	285	812	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q76IQ9	8.79e-68	11	507	280	781	N,N'-diacetylchitobiose phosphorylase OS=Vibrio proteolyticus OX=671 GN=chbP PE=1 SV=1
Q9F8X1	5.94e-66	3	507	272	781	N,N'-diacetylchitobiose phosphorylase OS=Vibrio furnissii OX=29494 GN=chbP PE=1 SV=1
Q7S0S2	2.44e-45	35	499	319	765	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001647_00679.