CAZyme Information: MGYG000001644_00876

Basic Information

• Species: UBA7173 sp900759895
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900759895
• CAZyme ID: MGYG000001644_00876
• CAZy Family: GH87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
657	MGYG000001644_18|CGC1	71299.52	4.7656

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001644	2897018	MAG	United States	North America

• Gene Location: Start: 34573; End: 36546 Strand: +

Full Sequence      

MRLKNLILSISVISVGTPLVSATPVPADELQRGYYDRPYLRYEAEPGECAGSNEFLLPPV
PYSQQPLQAEASNLTAARLSNKGDNVEWVCRRDADALTLRFSIPDGSKAPLSLLVDGQKI
VEIQLDSHWSWQYIPVTSQSKHPDKDPSGNKFARMRFDEVAVLLPEIIRKGSTFALVKEA
DNDVAYTVDFVELEKAPAPVRFEDVAGDKILYQGDGSTLQSVIDSNPGKTIFIPAGAYTI
PRRIMINADNTALVGAGMWHTSLYFSASSSSRRTYSARGFESYSNNITLEGFSVNSASNI
RYYDNNESYGIGKGLQGSFGASSVVRDLRIEHFECGAWIGDYGGVASDGLRVENCRFRNN
YADGINLCSGTKNAVVTHCSFRNNGDDDMASWSTGNVTSTNEFSYCTAEHNWRASSLAFF
GGKGNRAHHIHISDGMESGARITADFQGTGFDSGSTISLSDITIERCGTPAGAQGSLGDF
WGNRQPSLLIQAGYWYDINNLEVRRVDIYDTRNQGIAITSNGGRRINGLELHDVLVSGID
GDGWGIYMQANLVGSGHYSNLRCEGINEPSISNVPVRFDFTDVSAICEIEGDRILEAVAV
DGGIRLTGVDGQVNVCDISGRQVACLDVDGDMLVPVPAGIYIVCACGYSPVKVTVGR

Enzyme Prediction     

No EC number prediction in MGYG000001644_00876.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	32	572	3.4e-114	0.8408710217755444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14490	CBM6-CBM35-CBM36_like_1	4.92e-30	38	193	5	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
pfam13229	Beta_helix	4.44e-07	285	386	42	139	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	2.33e-04	291	443	2	145	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALM50452.1	9.54e-104	31	538	33	516
AOE54071.1	9.54e-104	31	538	33	516
QSB25510.1	1.41e-96	29	562	31	553
AOC97073.1	1.39e-95	31	562	34	554
QSW89273.1	3.68e-91	29	562	31	553

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZRU_A	8.23e-66	31	581	11	576	ChainA, Alpha-1,3-glucanase [Niallia circulans],5ZRU_C Chain C, Alpha-1,3-glucanase [Niallia circulans]
6K0M_A	5.44e-31	38	481	18	447	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
6K0P_A	5.66e-30	38	481	18	447	Catalyticdomain of GH87 alpha-1,3-glucanase D1045A in complex with nigerose [Paenibacillus glycanilyticus]
6K0S_A	5.66e-30	38	481	18	447	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]
7C7D_A	9.79e-28	36	575	56	559	Crystalstructure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus],7C7D_B Crystal structure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000276	0.999026	0.000173	0.000174	0.000169	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001644_00876.