CAZyme Information: MGYG000001644_00511

Basic Information

• Species: UBA7173 sp900759895
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900759895
• CAZyme ID: MGYG000001644_00511
• CAZy Family: GT4
• CAZyme Description: Putative glycosyltransferase EpsF

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	MGYG000001644_9|CGC1	42809.43	9.6836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001644	2897018	MAG	United States	North America

• Gene Location: Start: 27671; End: 28783 Strand: +

Full Sequence      

MNKRLNANCPRRVLQILTVMNRGGAETMVMNHYRALDRSKIQFDFLVHRQERGDYDDEIE
ALGGRIFRTMPIRPWSYPAYFRWLDSFFKMHQGEFIAVHGHIQENTGFALRYAKKYGIKN
LVASSHIADLGIDYKFIFRQFGKIWTNKYANVRLACGKEAGKFLYGKREFQLLNNAIDTA
CYKFSPATRKIKRHELGISDDAFVIGNVARFCPQKNHTFIIKVFAEVLKTRPTTVLLLVG
EGPLMEDTKKLARQYGVDTNVIFAGLRSDVPEILQTFDVFFMPSLFEGLPVSVIEAQAAG
LQCVLSDTIDRGTDLTGKLQFISLKEPINTWVKSFFYSYNQNRDSKWENIKKYDVHENIR
ILMDYYLLQS

Enzyme Prediction     

No EC number prediction in MGYG000001644_00511.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	199	307	3e-26	0.6875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03812	GT4_CapH-like	4.91e-117	12	360	1	354	capsular polysaccharide biosynthesis glycosyltransferase CapH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. capH in Staphylococcus aureus has been shown to be required for the biosynthesis of the type 1 capsular polysaccharide (CP1).
cd03807	GT4_WbnK-like	3.03e-48	12	307	1	295	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
cd03811	GT4_GT28_WabH-like	5.67e-39	12	308	1	294	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03801	GT4_PimA-like	6.79e-35	12	308	1	299	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd04951	GT4_WbdM_like	1.82e-25	98	307	83	293	LPS/UnPP-GlcNAc-Gal a-1,4-glucosyltransferase WbdM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after WbdM in Escherichia coli. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDZ80720.1	3.39e-112	10	366	3	364
AWD67009.1	3.39e-112	10	366	3	364
QGQ47228.1	8.20e-108	10	370	3	363
QQT00737.1	2.06e-107	10	366	3	362
ANE46258.1	1.07e-105	10	332	3	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5D00_A	3.10e-09	114	304	114	302	Crystalstructure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D00_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D01_A Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168],5D01_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168]
6N1X_A	7.25e-08	193	301	191	298	ChainA, Glycosyltransferase [Staphylococcus aureus subsp. aureus CN1]
6D9T_A	7.68e-08	193	301	207	314	BshAfrom Staphylococcus aureus complexed with UDP [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71055	1.09e-69	11	370	6	378	Putative glycosyltransferase EpsF OS=Bacillus subtilis (strain 168) OX=224308 GN=epsF PE=2 SV=1
P39857	2.15e-14	12	370	3	354	Capsular polysaccharide biosynthesis glycosyltransferase CapH OS=Staphylococcus aureus OX=1280 GN=capH PE=3 SV=1
Q58459	1.01e-11	102	307	108	307	Uncharacterized glycosyltransferase MJ1059 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1059 PE=3 SV=1
Q04975	1.88e-11	168	304	362	500	Vi polysaccharide biosynthesis protein VipC/TviE OS=Salmonella typhi OX=90370 GN=vipC PE=4 SV=2
A0R043	9.59e-10	113	304	101	303	GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001644_00511.