CAZyme Information: MGYG000001640_01285

Basic Information

• Species: Duncaniella sp900549445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp900549445
• CAZyme ID: MGYG000001640_01285
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
640	MGYG000001640_57|CGC1	71444.02	7.339

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001640	2860567	MAG	United States	North America

• Gene Location: Start: 5925; End: 7847 Strand: -

Full Sequence      

MNLNIRTLAAVAAAAMVAVSAAAQSVYPGQHAGKLKVTTCVPHKAEAFDLSEVRLLPGRV
HDNLSRDSAWMANISIDRLTHSFKNNAGIFAGREGGYESLKKYGGWESLDCDLRGHTTGH
LMSAYGLMYAVTGDELFRLKGDSIVAVLGKVQDALGNGYVSAFPEELINRNLRGEGVWAP
WYTLHKILSGLIDQYLYGGNSQALEIAVKMGDWAHGKLIGLPEETRAKMLRNEFGGVNEA
FYNLYSVTGNPKYRELAEFFYHNDVIDPLAEGNTDFGKKHTNTFIPKVIGEARNYELTGS
ARSGGIAGLFWNEMTRRHCFANGSLSQKEHYFDPAKMSEFVNGYTGETCCTYNMLKLSRH
LFCLDASPEVADYYERALYNHILAQQDPESGMVCYFLPLLSGAFKVFSTPEQSFWCCVGS
GFESHSKYAEAIYYRGDNRLMVNLFIPSALNWKEKGLRLTQTTRFPEEETTRFTVDSAPE
GEMTIALRYPAWSGKPEITVNGKRVKVSAKPSSYIDIRRHWKAGDVIEARFPMSLRVETA
PDNDRRGVLMYGPVLLAGNLGTEGLVAPAPFSDPTVRNDYYTYDYKIPAGLNTTLAVDPR
NPAKTIRRTGSDLRFRTSAGQEILPLYDANRIRYVVYWDL

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	52	557	3.2e-190	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	52	557	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.80e-115	50	572	9	520	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd09233	ACE1-Sec16-like	0.002	194	252	71	136	Ancestral coatomer element 1 (ACE1) of COPII coat complex assembly protein Sec16. COPII coat complex plays an important role in vesicular traffic of newly synthezised proteins from the endoplasmatic reticulum (ER) to the Golgi apparatus by mediating the formation of transport vesicles. COPII consists of an outer coat, made up of the scaffold proteins Sec31 and Sec13, and the cargo adaptor complex, Sec23 and Sec24, which are recruited by the small GTPase Sar1. Sec16 is involved in the early steps of the assembly process. Sec16 forms elongated heterotetramers with Sec13, Sec13-(Sec16)2-Sec13. It interacts with Sec13 by insertion of a single beta-blade to close the six-bladded beta propeller of Sec13. In the same way Sec13 interacts with Sec31 and Nup145C, a nuclear pore protein, all of these contain a structurally related ancestral coatomer element 1 (ACE1). Sec16 is believed to be a key component in maintaining the integrity of the ER exit site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII64638.1	1.72e-312	24	640	21	637
QJR69443.1	2.83e-311	24	640	21	637
QJR65180.1	2.83e-311	24	640	21	637
QJR73776.1	2.83e-311	24	640	21	637
ALJ62034.1	2.39e-310	23	640	21	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	5.56e-116	43	638	23	648	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.53e-110	43	638	23	648	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	3.78e-22	135	555	97	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	6.32e-21	135	555	97	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	7.01e-21	182	535	192	581	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000253	0.999117	0.000170	0.000163	0.000142	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001640_01285.