CAZyme Information: MGYG000001639_03126

Basic Information

• Species: Haloferax massiliensis
• Lineage: Archaea; Halobacteriota; Halobacteria; Halobacteriales; Haloferacaceae; Haloferax; Haloferax massiliensis
• CAZyme ID: MGYG000001639_03126
• CAZy Family: GH42
• CAZyme Description: Beta-galactosidase BgaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
663	MGYG000001639_4|CGC1	74290.48	4.2064

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001639	3991467	Isolate	not provided	not provided

• Gene Location: Start: 15834; End: 17825 Strand: +

Full Sequence      

MTVGVCYFPEHWSRERWETDISQMAEAGIEYVRMGEFAWGRIEPERGTFDFAWLDEAVEL
IGEFGMKAVLCTPTATPPKWLVDEHPDVRQRDRDGTPREWGSRRFTCFNSPTYRSETERI
VGVLTERYADNPHVAGWQTDNEFGCHETVTCYCEDCGEAFSEWLADSYETVADLNEAWGT
AFWSQQYDDFESVDPPKPTPAANHPSRVLAYERFSNDSVAEYNRLHADLIREANDEWFVT
HNFMGGFSLDAFRLADDLDFLSWDSYPTGFVQDRQPDTPTADELRAGNPDQVSMNHDLQR
GAKGKPFWVMEQQPGDINWPPQSPQPADGAMRLWAHHAVAHGADAVVYFRWRRCRQGQEQ
YHAGLRRQDGSPDRGYREASTAADELFDLDSVDASVALVHDYESLWATRSQPLSPDWDYW
NHLRTYYDTLRARGVQVDIVSPEASLERYDAVVAPTLYLVGDELSTALTDYVDSGGSLLL
GARTGEKDPYNQLHESLAPGPLTSLTGARVARHETLPDHIETRLSYDGATYEFRTWASWL
APEDGVPRGEYRTGEAAGNTAIVRNDAGNGTVTYCGCWPGDDLADALVTELLDAAGVEYT
ERFPDGVRVMERDGYTWALNFTSDPVTLTVPDSAGFLLGEATVDAFDIAVLDGSIGGVGL
GSE

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	6	386	2e-153	0.9919137466307277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	0.0	6	389	1	376	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	1.71e-142	4	652	19	671	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam08532	Glyco_hydro_42M	4.43e-79	394	598	1	207	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
cd03143	A4_beta-galactosidase_middle_domain	1.02e-34	396	597	1	154	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
pfam08533	Glyco_hydro_42C	4.09e-07	606	651	1	56	Beta-galactosidase C-terminal domain. This domain is found at the C-terminus of beta-galactosidase enzymes that belong to the glycosyl hydrolase 42 family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAB40123.2	0.0	1	663	1	663
QIB77591.1	0.0	1	663	1	663
ADE01962.1	0.0	1	663	1	684
QIO21067.1	0.0	1	660	1	661
QSG04795.1	0.0	1	658	1	659

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LVW_A	1.80e-310	1	647	1	663	PolyextremophilicBeta-galactosidase from the Antarctic haloarchaeon Halorubrum lacusprofundi [Halorubrum lacusprofundi ATCC 49239]
1KWG_A	9.94e-191	3	650	2	641	Crystalstructure of Thermus thermophilus A4 beta-galactosidase [Thermus thermophilus],1KWK_A Crystal structure of Thermus thermophilus A4 beta-galactosidase in complex with galactose [Thermus thermophilus]
6Y2K_A	2.13e-163	1	650	1	652	ChainA, beta-galactosidase [Marinomonas sp. ef1]
3TTS_A	2.08e-104	4	652	12	673	ChainA, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_A Chain A, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus]
4UCF_A	8.55e-91	4	651	23	687	Crystalstructure of Bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose [Bifidobacterium bifidum S17],4UCF_B Crystal structure of Bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose [Bifidobacterium bifidum S17],4UCF_C Crystal structure of Bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose [Bifidobacterium bifidum S17],4UZS_A Crystal structure of Bifidobacterium bifidum beta-galactosidase [Bifidobacterium bifidum S17],4UZS_B Crystal structure of Bifidobacterium bifidum beta-galactosidase [Bifidobacterium bifidum S17],4UZS_C Crystal structure of Bifidobacterium bifidum beta-galactosidase [Bifidobacterium bifidum S17]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94804	0.0	1	663	1	663	Beta-galactosidase BgaH OS=Haloferax lucentense (strain DSM 14919 / JCM 9276 / NCIMB 13854 / Aa 2.2) OX=1230452 GN=bgaH PE=1 SV=2
B9LW38	9.84e-310	1	647	1	663	Beta-galactosidase Bga OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) OX=416348 GN=Hlac_2868 PE=1 SV=1
O69315	5.44e-190	3	650	2	641	Beta-galactosidase OS=Thermus thermophilus OX=274 PE=1 SV=1
Q8GEA9	3.51e-188	3	650	2	641	Beta-galactosidase BgaA OS=Thermus sp. OX=275 GN=bgaA PE=1 SV=1
Q9X6C6	4.69e-183	3	650	2	641	Beta-galactosidase BgaT OS=Thermus brockianus OX=56956 GN=bgaT PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001639_03126.