CAZyme Information: MGYG000001637_01652

Basic Information

• Species: Agathobacter sp900543445
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp900543445
• CAZyme ID: MGYG000001637_01652
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000001637_12|CGC1	37484.17	9.8216

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001637	2652425	MAG	China	Asia

• Gene Location: Start: 82069; End: 83076 Strand: +

Full Sequence      

MKNWFQKCLIGILIAALCLTVVPVDTFAATKSSLPALHVEGTKLCDKDGNVVQLRGVSTH
GLSWFPQYVNDKYFKELHDKWGANVVRLAMYTEEYNGYCSGDANNRKQLKALVKKGVKLA
AKNDLYVIIDWHILSDGNPKKHVKASKAFFKEMSKTFKDYDNVLYEICNEPNGGTDWKTI
KSYAKSVIPVIRKNDKDAVIIVGTPNWSQKVDEAAASPITGYDNLMYAFHFYAGTHKVDM
RKTLTDAVKKGLPVFVTEFGITDASGYGGIDKKEAAKWIKALNKRDISYVAWNVSNKDEG
SAMIKSSCAKTSGLKRSDLSTSGKWIYDLLRKHKN

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	48	290	3.6e-97	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.88e-73	45	298	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	4.38e-11	80	302	84	367	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFA47670.1	1.58e-126	37	334	205	502
QBR94633.1	1.43e-124	29	333	86	389
QNM00780.1	5.84e-123	37	326	221	508
QWT53734.1	1.88e-121	37	326	221	508
SIP56455.1	3.68e-119	37	333	87	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	1.89e-95	37	332	13	302	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
3PZT_A	6.12e-92	37	326	37	320	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
4XZW_A	5.31e-87	37	326	12	298	Endo-glucanasechimera C10 [uncultured bacterium]
4XZB_A	2.01e-84	37	326	12	299	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
1A3H_A	2.15e-80	37	332	9	299	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P22541	3.44e-102	37	335	116	412	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1
P15704	3.26e-93	3	326	9	331	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
P10475	5.46e-89	37	326	42	325	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P07983	1.71e-87	37	335	42	334	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P23549	4.81e-87	37	326	42	325	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000248	0.999092	0.000175	0.000172	0.000159	0.000142

TMHMM  Annotations     

start	end
7	29