CAZyme Information: MGYG000001637_00641

Basic Information

• Species: Agathobacter sp900543445
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp900543445
• CAZyme ID: MGYG000001637_00641
• CAZy Family: GH87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1168	MGYG000001637_3|CGC2	127756.27	5.0024

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001637	2652425	MAG	China	Asia

• Gene Location: Start: 116215; End: 119721 Strand: -

Full Sequence      

MNVKKGKGNGRHYTGKAWKNLWHRMFAILLTCIMTIGNVPQMEAAAAVAQPEAQANQKEI
VYIQAADGKYLYASGDEDKAPVVIGDMDEENKSMYQWELLDQGDGSYWIQNFGTKAYFCI
EGDSGDPNPYIRLYKTIYEVWGSSKWIITESAEGVVLASKWTTGHIYAKANDGDNKVYHG
YESDTGYFKFTRENIAYTDPSLVGPEPMDANAPAAGVTIPEENSDMDSIGATMPYVRYDS
DKAILGGGATMAVSEDFHKDKIASQASNQSYIELPVSGAYAEWTVNASETDVNGITMRFT
LPDNEEGTGITGSLDVYVNDQKVKTVELSSYYAWQYLTAEGSAHNHSSEYDSIKEIKDAG
ITDYSKCFAFDEAHFLLDQKLNIGDKIRIQKTDADDIVYGVDFLELEKVGDPIAKPENAL
SVANYKDGARNDLEAIQACIEAAQNQNKDVYIPAGTYEIDEIWKLNAHDMKISGAGIWYT
NIKFTNPNRAGGGIEGQDTTRSIEFSDMYINSSLRSRYEENAAYKAFMGTFGGGSWIHDI
WEEHFECGFWMADYGEPMAYSDNLKITASRIRNNLADGVNFCQGTCNATVYNCSVRNNGD
DGLAVWNNDYLEAKDALNNVFAYNTIEFTWRAGAIAIYGGDNHKIYNNYIRDCFMASGIH
LNTNFGGYKFNHTNEIRFANNIIITSGSSYDIWNDIFSSVDVIGNVKNIVFENTYIYDSQ
HDGVRIGDNVAGIKFKNLHIYGTGLDRTTAGGNAVSHRGAAIFNRGGSAKMDVAIEGLTL
KNILNARLNVSASDGGKLVINDQKEEGNDGYTVPLGTNQNLYDAKSVGTLDRGDYDDNAA
FKMPDVIVKDVKWSPVSPKDGDKVVFSVTIKNIGDDATPEGKITGVNFLVDEKQVAWSDT
YTQAIQPGEEVSLTANNGPDGGVDWIATAGEHEVCAWVNDNGRYKEANTANNQTNVTFTV
SEKGSNSGSSAGSDNTVNLPADNKQDTPSTLPTDDKQDTPSTVPEYKVILNASEGVLQVG
KSTKAFEAVVSKGDKIISWSSSDKKIATVSKDGKITAKKSGTVIITVKTAKGAEATITLR
VQKDKVKTKAIEVTNVSKNKLKLKTGSKFVLKTTLTPISSPEKVKYTSSNKKVVTVNKNG
KLTAKKAGQAKITITSGNKKKTITVSVK

Enzyme Prediction     

No EC number prediction in MGYG000001637_00641.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	226	764	4.3e-152	0.8241206030150754

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14490	CBM6-CBM35-CBM36_like_1	3.75e-42	230	406	1	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
pfam13229	Beta_helix	8.72e-10	581	765	4	155	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
COG5492	YjdB	3.90e-09	983	1160	159	325	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].
pfam02368	Big_2	1.14e-08	1095	1165	4	77	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.
pfam13229	Beta_helix	8.59e-08	558	737	5	155	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX41685.1	3.92e-266	61	962	37	947
BBA29482.1	1.77e-180	229	966	38	764
ANR73273.1	4.89e-180	229	966	38	764
QUB45559.1	5.03e-180	229	966	39	765
QUB58650.1	1.07e-178	229	966	39	765

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZRU_A	2.92e-143	230	727	13	505	ChainA, Alpha-1,3-glucanase [Niallia circulans],5ZRU_C Chain C, Alpha-1,3-glucanase [Niallia circulans]
6K0M_A	1.12e-30	230	724	14	492	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
6K0P_A	1.12e-29	230	724	14	492	Catalyticdomain of GH87 alpha-1,3-glucanase D1045A in complex with nigerose [Paenibacillus glycanilyticus]
6K0S_A	1.12e-29	230	724	14	492	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]
7C7D_A	1.48e-28	230	694	54	468	Crystalstructure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus],7C7D_B Crystal structure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.048638	0.938473	0.010300	0.001984	0.000338	0.000264

TMHMM  Annotations     

start	end
20	39