CAZyme Information: MGYG000001619_01301

Basic Information

• Species: UBA9502 sp900540335
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA9502; UBA9502 sp900540335
• CAZyme ID: MGYG000001619_01301
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
730	MGYG000001619_16|CGC1	83958.36	5.5718

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001619	2970880	MAG	China	Asia

• Gene Location: Start: 11902; End: 14094 Strand: +

Full Sequence      

MKYKIDVVRIRENSIELNGWVIGKTPQSRAEFQVQDGNREPVEFRYVATRRDDVSQIYYK
QVYDRDYGFDIRFPYTRGADYWLLIRCDGKTARIKFNEELIAKRASVAHKRMEKIRDLMN
METVRVAVDFGKKHGLKALFLKSKHKLQGLDNDYDYGEWYDLTKPTEEELNRQRETKLPF
EPLLSVVIPAYKTPEKYLREMLDSILVQTYKNWEVCLVNGSPAGEGKIVERVMAEYTARD
SRFHYKNLGENLGISGNTNAAIEMAAGDFVVLADHDDTIPEQALFEVASAINEYPGCDVI
YSDEDKLDMDGGALFDPHFKPDFNPDLLTSVNYICHLFVVKRTLLEQVGGFRNEYDGAQD
YDFIFRCTEAAKEIYHIPRVLYHWRCHQDSTASNPESKLYAFEAGARAIMAHYERCKIPA
ESVEKGVDYGIYHTKFRIPGEPLVSVIIPNKDHAADLDLCIRSIIERATYRNLEFVVIEN
NSTESETFTYYEKLQKEFPQVRVVCWEREFNYSAINNFGAQFAAGDYLLFLNNDTEIVSP
GLFEEMLGFCQRPEVGIVGARLLYQDDTIQHAGVVIGFGGIAGHTFIGLHEAENSYFHRA
MCAQDYSAVTAACMMTKKEVFCQAVGFTEELAVAFNDIDYCMKVRALGKLVVYAPYAVMH
HYESKSRGLEDTPEKVARFNREVAIFARRWPDILKNGDPYYNPNLTLRKSNFALRDLLKE
KIGEPYKLEV

Enzyme Prediction     

No EC number prediction in MGYG000001619_01301.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	185	347	4.4e-23	0.9823529411764705
GT2	445	578	4.7e-19	0.7705882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.94e-106	182	386	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.51e-37	446	663	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06433	GT_2_WfgS_like	3.79e-23	185	391	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.90e-23	440	696	1	247	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	3.10e-22	185	345	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU23131.1	0.0	1	730	1	728
ANU48071.1	0.0	1	730	1	728
QQR03036.1	0.0	1	730	1	728
ASN97860.1	0.0	1	730	1	728
QRP37330.1	0.0	1	730	1	728

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	4.30e-11	183	281	6	99	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.69e-138	182	714	366	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.86e-100	155	715	292	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q1RIM7	4.60e-15	180	534	11	379	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1
Q4UM29	9.11e-15	182	534	14	381	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
Q58457	1.72e-14	182	402	8	231	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001619_01301.