CAZyme Information: MGYG000001619_00321

Basic Information

• Species: UBA9502 sp900540335
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA9502; UBA9502 sp900540335
• CAZyme ID: MGYG000001619_00321
• CAZy Family: GT111
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
630	MGYG000001619_3|CGC1	74515.34	6.1442

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001619	2970880	MAG	China	Asia

• Gene Location: Start: 20663; End: 22555 Strand: +

Full Sequence      

MEKQTVNKEPKIKIYVVCHKPSYVPENPYLYPIQVGTALSKSPLAGMLHDNEGDNISDRN
KSYCELTAQYWAWKNEDADYYGFFHYRRYFSFDPKLDRDDGWGNIAYDRISEAAIEEMKL
YPEEMKSLITKYDMISVKGRKYPRIQEGGALLDVYHEYGTVPFQHREDLDIALQVMEEKY
PEFKQIAREYMHSSVAHECNMFIMKKEIYHDYCAWLFDILFEAEKRIDTTWYSVEEYRIM
GYLAERLCGIYYMYLKQKEGVRTFELPKTLFHETAPKSTLEPVYENGVPIVLSANNKFAP
YLDVMIRSIAANASADRKYDIIILYNDISEKNRGLISWAAKAYENISIRFIRVCEYFDAD
KLFVDQHLSVETYYRLIIPEIMPGYHKILYLDCDMVVNHDVAELYDMDLQGCIIGAAKDI
DVAGQVNLKQNDWGKYAVEQLGLDKPFDYFQAGVLILDLDKLRQTASSEEMIQMALNHSY
RCHDQDILNIVCKNRVYYIPQQWNTLMDWQEPGRSRMQILKMAPRTLYEEYAAARKNPYM
IHFAGYQKPWDVVDCDMAEYFWEYAKLSPYYPRLLRRIQRCFEDEALNWEAQTRMERMGN
DPAIRKVANKLLPFGSRRREWVKKVVKRNK

Enzyme Prediction     

No EC number prediction in MGYG000001619_00321.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT111	14	253	4.6e-74	0.9861751152073732
GT8	280	551	2.7e-60	0.9027237354085603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14393	DUF4422	3.54e-98	13	254	1	218	Domain of unknown function (DUF4422). This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 255 and 371 amino acids in length.
cd04194	GT8_A4GalT_like	6.62e-70	288	550	1	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	2.08e-40	289	550	1	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	1.53e-33	289	572	4	268	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd00505	Glyco_transf_8	1.81e-21	290	551	4	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT50573.1	1.84e-156	12	626	4	608
QPK94470.1	3.77e-151	6	580	1	575
CBL13813.1	4.00e-144	12	616	4	602
CBL07790.1	1.64e-143	12	579	4	568
CBL13811.1	8.69e-138	11	626	3	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4B_A	6.92e-97	12	577	29	595	ChainA, WbbM protein [Klebsiella pneumoniae]
1SS9_A	3.92e-17	290	565	3	268	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	7.10e-17	290	565	3	268	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
5GVW_A	2.57e-07	367	568	82	254	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
5GVV_A	4.51e-07	367	565	82	251	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25148	1.41e-22	290	551	9	256	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2
P43974	2.97e-19	290	504	41	245	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2
A0A0H2URH2	7.27e-14	290	568	5	248	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1
P27129	2.02e-11	387	550	125	272	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
A0A0H2URA3	6.94e-10	286	593	2	280	Glycosyltransferase GlyB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001619_00321.