CAZyme Information: MGYG000001615_05662

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_05662
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
818	MGYG000001615_89|CGC1	94742.24	5.9264

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 6332; End: 8788 Strand: +

Full Sequence      

MGQSDKRQEDFWFTLLRREEERALWHPELELIFVLKGAGRVCLTQNGPVYRINEGDIFAV
NSFQILELELDGDAYALSLSISLHYLTSISPELLSHKVNCRSFLYPKDRQGLYDVLRRNL
ARAFQAQYKYEMRQSLSLKNRIAALLENLVQYFREEEEPQPEGGSWERLKPAIDYIQNNY
RDPITLEDLSEHTFLSRTYISHSFRRYLGVSFMEYLARVRICHAVRMMYGRETLTEIAYN
SGFPNVNAMIKAFKQYRGMTPGEYRKQAAQPQTALQPAAEEPDEMNHVFSSLMNYALGDP
EVKPPKETVRELVIDLEGRKPRITQHWKRIMNAGYARELLDGARQQEIILLQKQIGFEYI
RVKGILDDDMCLLRTDMIGNRVKNFTYVDEAIDFIVSAGAKPMVELSSMPRLLARSVSIP
SMRAGVISYPESLEAWKDLIQSLLEHLAERHGRERVRQWLFAPWLIPDYVDFGVCTAGEY
EEIYAVTYETIKSVCGNFLVCGPGTTDCRKYLPQFLAMCRRRDCMPDIITFRSFAAVNPE
EEEDGLNLIAGNESFPMAVSRDEDILFHLSREVHRILDQAGAGELPLVLEEWSSTIWQRD
LCNDTCYKSAYLFKNVLENNDRFSGMGYFSLNDRLDEIPPVPQMFCGGFGLFTKNSVKKS
AYRAMELLAQMGDRLLEKGGGYFISQRNEEIQIFLYNYCHYDLLYRYRHTVNMTQTNRYH
VFQPKEAEAFFIQLSHPVPGKYRIKRYAITRQGGSSYDAWLRMGAPETLTREETAFLEAG
SYPEYRTDCVEVQGEEPVLNIRASVKPLEVMLIKIQRE

Enzyme Prediction     

No EC number prediction in MGYG000001615_05662.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	323	770	1.5e-86	0.988399071925754

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	7.70e-44	322	787	13	461	Glycosyl hydrolases family 39.
COG2207	AraC	3.50e-28	149	272	2	126	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
COG3664	XynB	1.45e-26	345	817	7	426	Beta-xylosidase [Carbohydrate transport and metabolism].
smart00342	HTH_ARAC	1.54e-24	183	265	1	84	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	2.42e-21	189	267	1	81	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ24049.1	8.61e-231	10	817	10	819
AIQ37108.1	4.10e-138	25	815	30	824
AIQ21948.1	9.68e-136	11	817	16	843
AYA77562.1	2.22e-134	25	815	30	828
AWB46610.1	6.10e-128	25	815	31	840

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BFG_A	2.31e-49	320	817	11	482	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]
1W91_A	4.30e-49	320	817	11	482	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BS9_A	4.30e-49	320	817	11	482	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4M29_A	5.45e-41	313	816	10	497	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	7.37e-41	313	816	10	497	ChainA, Beta-xylosidase [Caulobacter vibrioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	4.63e-46	320	817	11	483	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
P36906	6.78e-38	322	815	13	479	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
P23552	1.03e-37	306	677	3	362	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
O30360	1.48e-35	309	787	2	453	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
Q6GKK1	5.36e-23	15	814	6	740	Uncharacterized HTH-type transcriptional regulator SAR0107 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=SAR0107 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001615_05662.