CAZyme Information: MGYG000001615_04114

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_04114
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
760	MGYG000001615_38|CGC1	85508.75	5.328

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 13608; End: 15890 Strand: -

Full Sequence      

MNFPQQFISASQEYADYGHQVPAPYIRKKFTLQAEPQSAELLITGLGFYRVFLNGTELTK
SILAPYISNPDDIIYYDHYDALPYLAKGENCIGVILGNGMQNAYGGFVWDFDKAGWRSAP
MTALRMDMELADGGSVSIESDTFFLTHPSPLLEDELRSGECYDARLSIDDWCSPSSPEDG
WRPVVKVTPPRGSLRLCQASPIRTYEKRRAVSIIPYEEGYLYDFGIDTAGVCELKISGRR
GQKVQISYAEWYHDGVLEKKNLMFPEYPSPHTADVQNSCYICRGDKEESYMPFFTYYGFR
YAYVTGIEKEQAVPELLVFHVCGGDFRENGNFTCSDGIANELQIMTRRASTSNFFWFPTD
CPHREKNGWTGDAALSAEHMLMNLTVEDSLREWLHSIEEAQSPAGEFPGIVPTGGWGFGT
GPAWDQIIAEIPFCLLKLRGDLDTAKEAAPFLFRYLFFLSGIRNERGLVDTGLGDWCETG
KSGGGQKAPIEVTDTAVCVHLLEEAKILFRRLHREPEYRYAAALRHELKKAFRKYLIDFN
TMTVAGSCQTSQAMAIHYGLFQKAERPQAFSRLLEMIHQNGDHMNAGALGLRILFHVLSD
YGQADLAFHMITRKDYPSYGNWIARGATSLWEDFLPPEAEVHSQNHHFFGDISSWFIQAV
AGIRPNPYLEDADYILVAPHFIQALTHAEAFYKAPSGRITVRWERTDGITDNAPGKMITL
TIQTTGSLTGSICLPGGWEFTDGFCEKQLHPGIYTCKCKA

Enzyme Prediction     

No EC number prediction in MGYG000001615_04114.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	219	708	9.9e-113	0.9484126984126984
CBM67	15	191	4.6e-24	0.9147727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.23e-75	327	660	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.51e-39	34	206	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.55e-14	220	310	8	90	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.49e-04	662	709	1	46	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	1.57e-139	21	704	141	818
AHF16194.1	3.10e-126	23	757	172	881
AYB33152.1	5.03e-125	22	708	183	858
QNN24933.1	4.12e-124	22	735	351	1055
ANH83620.1	8.00e-122	19	742	136	849

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.01e-82	23	709	176	881	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	4.10e-64	3	708	278	976	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	4.87e-58	27	742	135	855	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.67e-72	23	708	184	888	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	8.36e-66	25	704	176	856	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.42e-64	25	706	172	858	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	2.07e-63	3	708	278	976	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001615_04114.