CAZyme Information: MGYG000001615_02322

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_02322
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850	MGYG000001615_14|CGC2	96851.75	5.2696

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 73739; End: 76291 Strand: +

Full Sequence      

MEKLMLTEWKIGKAKCDFKASKQELSEKVNSTADVFLSAGQVAQVHEILIQNGLASAGVL
ENGDSSELAWASGYDWFYKTEFTIPKEEEHYFLFCKGLDTVCDIFLNGEYLGLSESMYLP
FEKDITDLVTLEGKNSLVLYFHSHEKMLEYFTDTMPERYRGCVPARAMLLKAEDYGADPG
KCRGYWNIGIFDEVYVEGFSVLKLHEIAIDVKLSQPFHAYDRAVVNYSVRGTAYRRGVIR
ADIKVSQADGSGPLLRAVSQQVEAGEFCMEGSIPVENPRLWWPRNYGEQPLYRFQAELSM
DGAVCTSVCRPFGIRDIRLTGNMTLYCNGEHIRLFGGDIAPVYGPSNVFHDQTAFDLIDK
IWLAGMNAVRIWGPSKPYPDRFYDRFDELGILVWQDFPTGGSELPCDGHYRELLAGQAEA
MLRRLRHHPCIYLWCGGNENIYMNEYYERSSNIGYDILTDTFRRLCNELDPERIYHVSCP
YEGKYTNDPDFGDSHGSRAFRRFLPGEPYGVFYSENIRVYPPQYKSMKRWLGAGMWDENY
TDVRPVGCIKPMPASWASRLGNFGEEKLGPIHEYYSADTPGSLIYKFTAAASQDIYQMYA
RTRRGKPHYKSEENTICQGFMLWKINDPWPNFYCALVDYYGECSMTYYAVKRAVRPVWID
LEVDDRVYLWGVNDTLSNFSGTVTLTAFRMDENRIDKQAEIPVSLLKDTSRVLTNLDFFG
PLHWHTVLHACLKEESGKALFTTTAFLKHENMLPFPDAILTLTVDGDSITVRTDRFARCV
ELSAGEDGEAFGWVFGDNFFNLLPFETKRVGIVRKGEGNCIRAKAQYSSTFTVCDLPVGG
KGDGNGQKEK

Enzyme Prediction     

No EC number prediction in MGYG000001615_02322.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	68	700	7.7e-72	0.6170212765957447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	9.21e-53	70	767	59	754	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.57e-12	78	483	113	476	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	1.60e-10	75	439	66	417	beta-D-glucuronidase; Provisional
pfam00703	Glyco_hydro_2	2.73e-08	210	315	5	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17786	Mannosidase_ig	3.08e-08	665	749	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB57903.1	1.22e-133	43	827	27	800
QMW77334.1	1.22e-133	43	827	27	800
QBE99501.1	1.53e-129	43	827	27	800
QBE99502.1	6.86e-129	43	833	48	837
QIB57902.1	1.42e-128	43	833	48	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	4.84e-65	45	804	52	802	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	2.94e-51	64	817	52	825	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	2.96e-51	64	817	52	825	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.99e-51	64	817	54	827	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	3.01e-51	64	817	54	827	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I2C092	3.63e-47	70	827	59	851	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
Q5B7W2	4.89e-41	30	685	20	698	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
A1CGA8	8.75e-41	67	657	57	656	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
B8NW36	1.48e-38	70	657	60	656	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
Q2TXB7	1.48e-38	70	657	60	656	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001615_02322.