CAZyme Information: MGYG000001615_02046

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_02046
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243	MGYG000001615_12|CGC1	27885.92	5.2384

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 29621; End: 30352 Strand: +

Full Sequence      

MRIIKKFIVTLIVVFFIGGCVAGGRLLWEGYRMYQEVITKEPLSDKVEEIRSKPHYTAID
QLPDTYKNAVVAVEDKRFYKHGGIDLISTFRAVFINLKEKKLAEGGSSITQQLAKNMYFT
QEKKFLRKVAELFVAFQLEQNYSKDEILELYVNTIYFGSGYYCVYDAAQGYFEKEPGEMS
DYESTLLAGIPNAPSVYALTNRPELAAQRQRTVVECMVEQKFLTREEGERILQEGDQTVQ
GNE

Enzyme Prediction     

No EC number prediction in MGYG000001615_02046.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	51	217	1.3e-59	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	8.88e-76	56	218	15	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	3.09e-74	56	243	4	195	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.94e-67	1	234	8	257	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.57e-65	1	234	2	247	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	1.07e-52	7	234	13	231	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO38940.1	2.37e-87	1	233	1	233
QJU22158.1	3.07e-81	29	226	28	225
QRP41835.1	2.50e-80	29	226	28	225
ASN93505.1	2.50e-80	29	226	28	225
QNM09777.1	1.03e-78	27	232	36	241

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	4.25e-45	53	229	19	195	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.70e-44	53	229	19	195	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	1.87e-39	45	223	48	232	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	1.93e-39	45	223	12	196	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	1.99e-39	45	223	13	197	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4L7I0	5.60e-41	45	224	71	256	Monofunctional glycosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=mgt PE=3 SV=1
O87579	1.84e-40	56	234	70	248	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
P38050	4.81e-40	58	227	71	240	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O66874	5.08e-40	53	229	62	238	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
O86088	6.41e-40	56	234	70	248	Penicillin-binding protein 1A OS=Neisseria cinerea OX=483 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.210748	0.106693	0.680361	0.000523	0.000418	0.001248

TMHMM  Annotations     

start	end
7	29