CAZyme Information: MGYG000001615_01296

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_01296
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000001615_6|CGC3	39402.52	4.7003

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 75782; End: 76801 Strand: +

Full Sequence      

MKRIEEACERAQYALWNKFWDQEKAVFVNHYPVKEVESWIYWWHAHVLDTLLDGYARTKE
KDYLERFKAEYEGVFRENGGTFLHNWYDDMEWMTLALIRAFDSTGEKRYMKEAVSIWNDT
KTAWNNCCGGGMAWKKDQPDYKNTPANGPAAIIAFRLYRRLGRKEDLEWGEKILKWNLEH
LMDPDTCFIWDGMNRLGDGAVDYDWKFTYCQGVIVGAAVEYAGITNHKEYLELAGKVARQ
AVTELADEDGIFPYEGPDDCGLFRGIFFRYVYELTQMSDEFEDLKEIIIKNARLIAEKGM
NEEGLAGGDWRQTAEGTIDLAQHLSAVMTLEMAAKLSNR

Enzyme Prediction     

No EC number prediction in MGYG000001615_01296.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	5	331	1.3e-80	0.9245810055865922

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	6.93e-65	3	336	2	352	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	1.77e-33	41	327	34	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
cd04791	LanC_SerThrkinase	7.62e-04	95	288	93	275	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
COG1331	YyaL	0.002	43	119	412	499	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97536.1	1.48e-116	9	336	10	340
AGA56980.1	9.19e-110	9	320	19	332
QDH23029.1	3.01e-109	12	338	384	715
QUL53853.1	3.64e-109	12	336	21	350
AYQ74079.1	1.65e-108	19	336	4	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	1.58e-73	6	336	5	340	ChainA, Lin0763 protein [Listeria innocua]
6SHD_A	8.88e-71	37	336	84	389	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	2.84e-69	37	336	85	390	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	2.23e-68	37	336	85	390	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4D4A_A	1.26e-19	9	330	29	359	ChainA, Alpha-1,6-mannanase [Niallia circulans],4D4A_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4B_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4B_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4C_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4C_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4D_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4D_B Chain B, Alpha-1,6-mannanase [Niallia circulans],5N0F_A Chain A, Alpha-1,6-mannanase [Niallia circulans],5N0F_B Chain B, Alpha-1,6-mannanase [Niallia circulans],6ZBX_A Chain A, Alpha-1,6-mannanase [Niallia circulans],6ZBX_B Chain B, Alpha-1,6-mannanase [Niallia circulans],7NL5_A Chain A, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001615_01296.