CAZyme Information: MGYG000001610_01569

Basic Information

• Species: Sporanaerobacter acetigenes
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Sporanaerobacteraceae; Sporanaerobacter; Sporanaerobacter acetigenes
• CAZyme ID: MGYG000001610_01569
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310	MGYG000001610_10|CGC1	34251.72	6.389

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001610	1892589	MAG	China	Asia

• Gene Location: Start: 56434; End: 57366 Strand: -

Full Sequence      

MKKIKEKVCIGLIVSTVGISSTSFAAPYTVKSGDSFWKISNQFNVSLESLLKSNNANDKT
VIYPGQVLEIPNGKKTIVTTTNRSTTSREIPKIIVHTVESGENLWIISQKYNVSMDQITN
ANEDLTENAVLNIGQELIIPISYTQVDKPIDENYGEYLDWFSDVNNGVLPIGTVFKVKDF
YTGKTFTMKRTMGSYHADCEALTSEDTEVIKDIWEGFSWVRRPVLVQVGDRVVAASMTAM
PHAGNDSAEGGKYTEWRSGGYGPGTNLDYIKGNGMDGHIDIHFAGSKRHKDGQIDPDHQK
CIKIAAGLTK

Enzyme Prediction     

No EC number prediction in MGYG000001610_01569.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	1.40e-15	20	139	474	591	1,4-beta-N-acetylmuramoylhydrolase.
cd00118	LysM	3.81e-12	28	70	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
PRK06347	PRK06347	1.77e-11	20	149	325	462	1,4-beta-N-acetylmuramoylhydrolase.
smart00257	LysM	2.10e-11	28	70	2	44	Lysin motif.
pfam01476	LysM	3.40e-11	28	71	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT60909.1	2.94e-129	1	310	1	335
QIB26928.1	1.37e-93	1	310	1	361
AFS79155.1	9.41e-92	1	309	3	308
ANV75307.1	1.49e-88	3	308	2	422
ALX07567.1	1.49e-88	3	308	2	422

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O07532	2.46e-14	20	139	234	350	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
O31852	9.76e-13	5	139	2	131	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
Q2G0D4	1.23e-12	25	146	26	132	Probable autolysin SsaALP OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_00671 PE=1 SV=1
P39046	3.53e-10	26	139	336	455	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q5HRU2	6.98e-08	6	137	2	125	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000307	0.998996	0.000183	0.000184	0.000170	0.000148

TMHMM  Annotations     

start	end
7	29