CAZyme Information: MGYG000001609_02511

Basic Information

• Species: Cloacibacillus porcorum
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Synergistaceae; Cloacibacillus; Cloacibacillus porcorum
• CAZyme ID: MGYG000001609_02511
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
287	MGYG000001609_31|CGC1	31779.72	10.334

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001609	3330624	MAG	China	Asia

• Gene Location: Start: 41119; End: 41982 Strand: +

Full Sequence      

MRKIMKKRHFHLSQIAVMLLLFISVIMHPKAGMSSTESSPKTHSTLSDGTVITTVSETAL
TENVVMTENKTSVVYTEQTETGESPKETPQEKSPAPFDKSIYAALKHQGLTEQHIGVWQE
EHPLSTLNKLGTLAPAKQKKVANVAAFIRKVNPKISAKTAWREACALVFYSVKYNVSSDL
VVSIAKAESRFNPSAQSKAGALGVMQVMWKVHNGMLRAKGIAPTRDHMFDPERGVEAGVL
ILSRYMSAYGTVQKALNRYYGGIAHNYLKKVNNNMAMLQRHSDKTGY

Enzyme Prediction     

No EC number prediction in MGYG000001609_02511.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	177	283	1.3e-17	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01464	SLT	6.44e-19	169	276	3	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	3.55e-17	179	262	2	81	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	4.75e-16	170	265	11	108	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13400	LT_IagB-like	7.81e-16	174	280	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16893	LT_MltC_MltE	5.80e-15	170	273	6	95	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANZ46429.1	2.03e-155	66	287	1	222
ACZ18328.1	1.12e-56	82	279	60	256
AFM20682.1	2.69e-53	97	279	49	230
QTX32309.1	6.32e-42	97	282	80	264
QVL36175.1	6.32e-42	97	282	80	264

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	1.54e-07	171	263	182	278	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	3.71e-07	171	263	182	278	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1CEV1	3.13e-10	171	263	199	295	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=mltC PE=3 SV=2
A9R6R2	3.13e-10	171	263	199	295	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis bv. Antiqua (strain Angola) OX=349746 GN=mltC PE=3 SV=1
Q666M2	3.13e-10	171	263	199	295	Membrane-bound lytic murein transglycosylase C OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=mltC PE=3 SV=2
B2K0V2	3.13e-10	171	263	199	295	Membrane-bound lytic murein transglycosylase C OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=mltC PE=3 SV=1
Q1CB94	3.13e-10	171	263	199	295	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.186054	0.799105	0.011457	0.001078	0.000723	0.001558

TMHMM  Annotations     

start	end
9	26