CAZyme Information: MGYG000001607_01430

Basic Information

• Species: Dorea_B phocaeensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Dorea_B; Dorea_B phocaeensis
• CAZyme ID: MGYG000001607_01430
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1409	MGYG000001607_14|CGC1	156040.24	4.384

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001607	2347571	MAG	China	Asia

• Gene Location: Start: 386; End: 4615 Strand: +

Full Sequence      

MAFVMTACMVWPSATALAEAENEDVNIPKPYYEYTFDEPAEGTTVHNQGTKEGADAKIEG
SGDGLGIVDDNWRGSKVLNLPGGGLGKGCLTLPEDMFSEVTNEGFAFSFWINIDENADHY
NRIFSASSFKMNSNNGDNGAWNAPEFTFVTGGTDVSGTAYNTSIMMSDRKRQMKLVWDKA
FAKGQWQHVTVSVSPSSYDVYLDGQKINTTDKNKNMTAILQSLFADNGKELKGYKYNAIG
RSVYSTDNDLKAKVDEFRFYNVALSAQQAKNAYDSYAVDQSKLDKLKKKISKLKEYSISF
YTRETYEVLEEKLLEAEQVASNPVTDANVDRMLGELDLAKDGLVYYKGVTSKTTFTNAQL
KEETEIAQELAGYDTLLEESKTALDTAVSEALAVLEKGKTADQSEVDDALRGIRAAVDQA
EYDAALHFDASENTGDIFHGSTGFLYGVSEAGVPSSDLIKAIQPKILVQKAADGKQHPSG
DGYRLEKYLTECGVENIQIYLQDYYLEWPYENTGIDDYKAKVETVVRKIVEGKTEEELSK
YSFVLFNEPNSIWYWNNINGLCKDWKTIYDTVKGIHPSLKVAGPNYSAYNSNDYRIFFEF
CRDHNCLPEYITWHELQKESLTSFQSHCDEVKEYVKTYYADSDIQPILFVNETVNFDDIG
TPGQLVNWLSIFEEEKIYASLPYWGLANSLNELAADNNKPNGAWWTYKWYNQMTGHTIPV
RLENIDAPSAYGRLYGLSSVDEDNSMIYTLFGGQAGNQTICIDNIKETDTFKNADSAHVK
IYRSKFTGHHGFADETPVVFEGDVKFTGSNLIYTVKDAELMDAYFAIVTPATGKETSQYA
TGPWQETYEAEEAALIGNAQAFTKTGGGDLARSNRAEVGGLNSGNDGVEFTVDVPWEGQY
RLNVYYTNQAPQVDPMTLEYVDAGGQNRAIGAQVTHKLTVDGEEKDTIVYDSTVKWGYYN
YKTVYLDLTKGEHKIRLMHSGADQNGKDLNSMLCAILDKIDLTRVTEESGKILIEPEELA
GSEKGFAFSRNADAYTGSGCAKGSGDFSFYVCAPKDGYYTMTTAGSGSAKLAKNVMVYAK
DAKAQSEVGMKWQELLTLNLGKEENAKIWLTAGMNELKLSGKELLIDQIVFEEDPEAAKN
STAVIEAEECALSGTDKEDGYHYLKGSAAVPKVIETENASGGKATEGFCGGNDNAITLKV
NVKEAGNYKLSVYYSNNEPAPVMKKQNGENYVHPYNTDLVERYTQIAVNGETPQTVYFRN
TFCWDVYKNMVVDVTLEAGDNSITFTNDNSYKFSDVQDDFAPRFDKFEIAPAVLKGTGQT
PPDPEIPDPEVPDPEDPDPEVPDPEVPNPEDPIKPGEDSKVDSGTSETGSNGSKAAKTGD
SNDTLTYVLLILLTSGCIVVGYKRRKMSK

Enzyme Prediction     

No EC number prediction in MGYG000001607_01430.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	514	693	4.8e-21	0.3805104408352668

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04081	CBM35_galactosidase-like	2.35e-21	1163	1309	9	125	Carbohydrate Binding Module family 35 (CBM35); appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. This family includes carbohydrate binding module family 35 (CBM35); these are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. Examples of proteins which contain CBM35s belonging to this family includes the CBM35 of an exo-beta-1,3-galactanase from Phanerochaete chrysosporium 9 (Pc1,3Gal43A) which is appended to a GH43 domain, and the CBM35 domain of two bifunctional proteins with beta-L-arabinopyranosidase/alpha-D-galactopyranosidase activities from Fusarium oxysporum 12S, Foap1 and Foap2 (Fo/AP1 and Fo/AP2), that are appended to GH27 domains. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). Some CBM35s bind their ligands in a calcium-dependent manner. In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates, while family GH27 includes alpha-galactosidases, alpha-N-acetylgalactosaminidases, and isomaltodextranases.
pfam13385	Laminin_G_3	1.11e-15	90	268	7	149	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
cd04083	CBM35_Lmo2446-like	6.34e-10	847	983	2	114	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04086	CBM35_mannanase-like	1.24e-09	1143	1288	1	107	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
cd04083	CBM35_Lmo2446-like	1.16e-08	1146	1290	4	113	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF45384.1	0.0	15	1315	13	1324
BAK20929.1	0.0	426	1315	61	958
BBC61544.1	0.0	426	1315	61	958
AIM25582.1	0.0	426	1315	61	958
BAL62658.1	6.61e-255	669	1315	1	654

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5U22_A	5.41e-34	439	831	38	423	Structureof N2152 from Neocallimastix frontalis [Neocallimastix frontalis]
2WZ8_A	1.43e-14	1151	1310	3	147	ChainA, Cellulosome Protein Dockerin Type I [Acetivibrio thermocellus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001484	0.982388	0.015172	0.000398	0.000289	0.000248

TMHMM  Annotations     

start	end
1385	1402