CAZyme Information: MGYG000001606_01525

Basic Information

• Species: Enterocloster sp900547035
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900547035
• CAZyme ID: MGYG000001606_01525
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		36051.53	9.5743

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001606	3723499	MAG	China	Asia

• Gene Location: Start: 41319; End: 42254 Strand: -

Full Sequence      

MEVRKRVDVIIPVYRPDKKFARLLRMLSLQTYPVNRIIVMNTERSFWNDKGFEGIKGLEV
HHLTKEEFDHGDTRNRGARYSRADYLLFMTDDAVPADEHLVEQLVAAFDQRGPGGESVIM
AYARQLPDKDCPLAERYTRAFNYPDKSRLKTKADLKELGIKTFFASNVCCAYDREKFWFQ
GGFIRKTIFNEDMIFAGKAILEDDYAVAYVASARVIHSHNYTCMQQFRRNFDLAVSQADH
PEIFSKVSSESEGIRLVKQTARFLAGQHKPWLIPGLVVKSGFKFMGYRLGKCYRLLPGPL
RVRCSMNKEYW

Enzyme Prediction     

No EC number prediction in MGYG000001606_01525.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	2.88e-12	8	177	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.73e-10	9	114	1	109	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG1216	GT2	1.69e-08	4	222	2	224	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
COG0463	WcaA	7.04e-08	4	229	2	211	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam13641	Glyco_tranf_2_3	7.08e-06	6	237	3	223	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU21869.1	2.56e-187	6	311	21	326
QRP41516.1	7.00e-185	6	311	21	326
ASN93818.1	7.00e-185	6	311	21	326
ANU46591.1	9.93e-185	6	311	21	326
QQQ98694.1	9.93e-185	6	311	21	326

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	6.87e-51	6	311	2	302	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001606_01525.