CAZyme Information: MGYG000001605_01470

Basic Information

• Species: Enorma sp900538305
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Enorma; Enorma sp900538305
• CAZyme ID: MGYG000001605_01470
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
895	MGYG000001605_20|CGC1	102507.81	6.6935

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001605	2046650	MAG	China	Asia

• Gene Location: Start: 25947; End: 28634 Strand: +

Full Sequence      

MTDTDMMFDVSVIIPVFNTEQYVADTLLSLERQTIGFDRIQVLIIDDGSTDSSLEICRQF
ANTHPDNVTLISKENSGVADSRNVGLSLSKGRLVTFLDSDDQWSDNAFETAVDFFDHNDS
SLEVLVADMNLIGKEGGKHTLSYRFMGEDHTIDVQVEPCSIQSTINCFIKREAVAGISFD
TDISISEDTLFFTKVISRQQKYGCTSRCCYYYQKREDGSSASQRRTIGRHLENLEVCRRL
LSFENRRDPSPFAQAVALYILCWQVFDSLDDAPTDGQKDDWTHRFTSTLKQIDDSIICNA
PWLSQKKRLYFLQLKHGADVVERFDWEDSARAYLHDSKVFTLNSSGPCSIYQLDRRGDIL
HIEGTTNLSCFMKPFSIQVSSDDGTVYPAKLAAFPREDTTSLVGTKLYAGYRFIVDLPAR
PGMNYSFSCTIDGVASNPLRLFPRFYTFAKLDEKYRHSYCVMNDLIIKYRGKRLWTFSYR
KRTHIASELRHLREIISDRKFSRKARASFTLLRILYHVANSVKKKPVWLFYDKEWKAGDN
GENVYRRAMQRLDLADIDRLFVLSESSPDAKKVSEYGTVLDPDTRKFKLKFLLADKVFSS
RCEFSVLYPFAKRTRLVRDLLSFDFIYLTHGTLFGDLSSMLNKVNKMITLFSVSTEMERQ
ALLRPEYGYADSEVKLLGMARYDAYKHAHADKTIAFLPTWRSHIAGKIIPGTTEREYSPT
FKDTEYCKQYNSLINDPRLIASMKRNGYRGEFYVHPSHDKQAGDFKGNEVITVGEHSADY
EKVLSTSSLLITDYSGVGFDFGYQRKPIVYTQFDSIFEGGHTYGQETYFDYQRDGFGPVA
QSIDAAVDKIIGYIESGCVMEATYRQRADRLFGYSDYNACDRILDAALQLDSSRC

Enzyme Prediction     

No EC number prediction in MGYG000001605_01470.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	11	125	3.6e-28	0.6647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	1.50e-29	12	119	1	106	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	1.05e-26	11	174	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam04464	Glyphos_transf	1.21e-24	522	886	2	357	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
cd06433	GT_2_WfgS_like	2.09e-24	11	223	1	202	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
PRK10073	PRK10073	9.19e-21	10	119	8	114	putative glycosyl transferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAN76649.1	1.95e-290	8	893	4	895
BCS56836.1	4.60e-283	8	894	4	894
BCA89062.1	9.22e-283	8	894	4	894
QHM18988.1	5.80e-141	1	894	1	897
AYE66140.1	1.12e-135	1	894	1	897

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.83e-13	10	101	7	95	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
5TZE_C	5.73e-13	11	194	4	184	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	1.29e-12	11	194	4	184	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]
3BCV_A	2.52e-12	10	110	7	104	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
2Z87_A	1.51e-10	10	145	376	507	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P46918	2.24e-136	1	894	1	897	Minor teichoic acid biosynthesis protein GgaB OS=Bacillus subtilis (strain 168) OX=224308 GN=ggaB PE=3 SV=1
P46917	5.82e-28	11	203	3	199	Minor teichoic acid biosynthesis protein GgaA OS=Bacillus subtilis (strain 168) OX=224308 GN=ggaA PE=3 SV=1
D4GYH2	1.24e-15	10	195	9	190	Glycosyltransferase AglI OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglI PE=1 SV=1
A0A0H2UR96	1.55e-13	10	110	5	103	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
A0A0H2URH7	1.23e-12	10	110	7	104	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001605_01470.