CAZyme Information: MGYG000001599_03223

Basic Information

• Species: Phocaeicola sp900544075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900544075
• CAZyme ID: MGYG000001599_03223
• CAZy Family: CBM9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
682	MGYG000001599_67|CGC1	79384.28	5.8289

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001599	4213385	MAG	China	Asia

• Gene Location: Start: 1410; End: 3458 Strand: -

Full Sequence      

MRKQLIGSLLALAVAGQLWGQGLYEKYERMLTLPEGYVCYRVDGKIKVDGKLNEADWQKA
QSTSSFVDISGEGFAKPCYDTSAKMLWDDNYLYVGAVLQEDDIKAKLSQRDTIIYYDNDF
EVFLDPDGDGQNYFEIETNAKGVIFDLMLDKPYRSGGNFMIQWDCPGLQLAIHREGTLNK
SKDKDKQWSVEMAIPHKALTVNFSNPDQAGNCWRINFSRVQWLKPGQREENWVWMPTGRI
DMHMPDRWGFLYLSDKVIGTGTDSFKYPYNMAAYKLLWAMFYAQLDNYAKEKNYIRSKEN
FFLTEAELKDLPAGAEILVEATQRTFCMSVSVPEEKVRYVVDHNGRFTREAITPRQVKNW
VWMRINKEKGDAYYKKYFALMKECGISGVMFEGYDEATYRMCKEAGLEAHYWKWTMNRRE
VRETHPDWFAVNRKGESCYDKPAYVDYYRFLCPNHKGVAEYLAADYLKEANLPYVDGVHL
DYVRFPDVVLPVSLWKNYGIEQTSELPEYDYCYCEVCRKMFKEQTGKDPLELKYPMEDQS
WINFRLDGITRVVNKITQTIKADGKRISAAVFPGPSMARKMVRQDWGQWSLDAYFPMIYN
GFYYEGPEWIGRSVKESVQTINGRAKIYAGLMFPDIKNTFEQALDEAFNNGASGVSFFDG
PDEEYLRKFKAYLDKRGFEVAK

Enzyme Prediction     

No EC number prediction in MGYG000001599_03223.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	48	251	5.7e-40	0.9835164835164835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09620	CBM9_like_3	2.09e-75	48	250	1	200	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
cd09618	CBM9_like_2	3.44e-30	37	220	2	170	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.
COG1649	YddW	4.53e-16	356	659	84	368	Uncharacterized lipoprotein YddW, UPF0748 family [Function unknown].
pfam06452	CBM9_1	4.57e-11	48	205	1	138	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
cd09619	CBM9_like_4	1.37e-08	48	139	4	94	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ32632.1	0.0	21	680	27	686
AUI46257.1	0.0	21	680	27	686
QTO24490.1	0.0	21	680	27	686
QCQ37007.1	0.0	21	680	27	686
QCQ51220.1	0.0	21	680	27	686

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001095	0.997995	0.000275	0.000208	0.000211	0.000194

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001599_03223.