CAZyme Information: MGYG000001599_02487

Basic Information

• Species: Phocaeicola sp900544075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900544075
• CAZyme ID: MGYG000001599_02487
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
941	MGYG000001599_27|CGC1	104784.77	4.9557

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001599	4213385	MAG	China	Asia

• Gene Location: Start: 30466; End: 33291 Strand: -

Full Sequence      

MKILITLSLLFFGGASVYSQKIPSVYKPVKKEIYHKGWIDFNKNGVKDVYEDPSAPIDSR
IEDLLSQMTMEEKTCQMVTLYGYKRVLKDDLPTPEWKTSLWKDGIGAIDEHLNGFQQWGL
PPSDNPNVWPASRHAWALNEVQRFFVEETRLGIPVDFTNEGIRGVESYRATNFPTQLGIG
HTWNRNLVRRIGEITGYEARMLGYTNVYAPILDVGRDQRWGRYEEVYGESPYLVAELGIE
MVKGMQKDYQVAATAKHFVAYSNNKGAREGMARVDPQMSPREVEMVHVYPFKRVIQETGL
LGVMSSYNDYDGIPVQGSYYWLTERLRGEMGFRGYVVSDSDAVEYLYTKHGTAKDMKEAV
RQSVEAGLNVRCTFRSPESYVEPLRELVKEGGISEETINSRVRDILRVKFLIGLFDSPYQ
MQLAEADKVVENLEHEAVALQASRESIVLLKNDNNTLPLDINKVKTISVCGPNADEEGYA
LTHYGPLAVDVTTVLEGIKDKVAGKAEVLYTKGCDLVDANWPESEIIDYPLTADEKMDID
KAVENALKSDVAVVVLGGGQRTCGENKSRTSLELPGRQLQLLQAVQATGKPVVLVLINGR
PLSVNWADKFVPAILEAWYPGSKGGIAVADVLFGDYNPGGKLTVTFPKTVGQIPFNFPAK
PASQVDGGKNPGPDGNMSRINGALYPFGYGLSYTTFEYSDIRISPKVITPNETATVTLKV
MNTGDMAGDEVVQLYTRDVLSSVTTYEKNLAGFERVHLQPGETKEVKFTIDRKHLELLDG
DMKWVVEPGEFVVMAGASSEDIRQTTVLNVEDYHTRNARLEAEKPEKPVSASTNPEDVMK
VLDGDNTTYWQGNKGDYLTFALKGNPKVDEVSITFVRENNLPSTFEIQLSGGGGQFLTVY
NGTVTEYGKPITYKFKGTTASDLRILLNDDRVGVAEVNIVR

Enzyme Prediction     

No EC number prediction in MGYG000001599_02487.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	147	372	3.4e-64	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	58	806	35	761	beta-glucosidase BglX.
PLN03080	PLN03080	1.72e-101	52	796	44	769	Probable beta-xylosidase; Provisional
COG1472	BglX	7.77e-77	134	500	41	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.54e-68	447	693	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.30e-60	69	408	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT62569.1	0.0	1	937	1	940
QQA31118.1	0.0	1	937	1	940
QUT34231.1	0.0	1	937	1	940
BBK89234.1	0.0	1	937	1	940
QUT68890.1	0.0	1	937	1	940

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	5.61e-135	57	803	10	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.05e-134	57	803	10	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	4.76e-129	47	814	4	760	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	3.60e-128	47	814	4	760	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5TF0_A	1.49e-125	138	805	68	746	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.54e-143	150	811	62	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	4.63e-135	58	804	35	759	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	9.74e-134	58	804	35	759	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	1.04e-122	50	806	29	751	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	1.14e-101	53	815	30	783	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000274	0.999107	0.000154	0.000160	0.000146	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001599_02487.