CAZyme Information: MGYG000001597_00587

Basic Information

• Species: UBA866 sp900543295
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA866; UBA866 sp900543295
• CAZyme ID: MGYG000001597_00587
• CAZy Family: GH85
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1060	MGYG000001597_20|CGC1	117215.53	4.0852

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001597	2473217	MAG	China	Asia

• Gene Location: Start: 15553; End: 18735 Strand: +

Full Sequence      

MTTEEILAGILSATTDPYQTANNPNRGTPNEGSDQQAWPGLAAFISERSVINGSNFYTNF
NTGHGMQYFLNGAVSNDNEWSNINIQDILPTWQWWIETEGTRVQVDFDYGTKYNAAFDLT
QVGGYNGGSSLVVRGPLDAENFIRLYKTKLSINKDSELSLVYNKTSKTDDSEMRIGLIFE
DQPETIEYVTVPNANRQTNGWVSKTLDLSAFVGRTLAGFGLAFDTNEGTIQNYQMNIGEI
RISDGSVKAPTAPQGLKVDNFFTTDEVYLSWNLADYDEVQRYNVYAVYEDGSKIYLGGTY
DDVYYIKDLYNTNGTVSIQVTAVGKDGIESAPAVVSVNGANVAENVTITENPGYFDVSFD
ASVEYDKAEISVSFPEKPEYSFTKTVSGDVNTTAIEVPMADGSRYVLRVTLLDKAGDVIS
FTDIAGTLPDYYCDEYDRDLTFKNNLLSFPSPGVDDWHYIYAYYKGEPVKFRSGNTQGIR
GYDDMRNVYITDVSGVMEVVLEDYAGNKSKAVKVPFHKDGMTCTAIDETFFPDSALREAV
LAAAKTADRVDEIETLDLSGTNVKSLTGIRYLKNLKSINLSDCTELVSIPEGTFSLNVKL
SEINLSGCTALRAVSLADTTLEKIVCEDADALEELLYLNISNAKFDLSEGTPEREFANTV
AARAEGQADFGVLGSEAVNVAFNQKIVNANGFGSTWYLLDGDHSNAFRCSWITKDAASFD
IDFGHEQEVISYSFFVPNDDPNVCYKSFRLQASNDGQTWEDVSVVTGYTGASTSITLEKP
VKASWYRFIVDERAGVPAKMTEFEMYGYQDTMYTPGVSYENQRPALYEKAVPSEIFLEKQ
EGTYHPASLLGFYETVRGISPEALKEAEFVDPNYDIDAECPVSEVVYSSFLKLSKPEAGN
TFMNEIDTNEDATYRVRIRDFASGKHDADHYEELTLVVGEGGELYDPDYEEAREALESLI
ETVEGMDRGTKYTDESLKALDEALTGARDALANAETAEELWNAYDKLEGAINGLVEKTTD
GNDSESPDTGDYDIGFAAMVMMIAAGALFGVFFVRKHKHS

Enzyme Prediction     

No EC number prediction in MGYG000001597_00587.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4724	COG4724	3.25e-44	26	244	351	551	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].
cd06547	GH85_ENGase	3.34e-19	18	100	246	339	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
pfam00754	F5_F8_type_C	3.81e-09	697	795	16	117	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam03644	Glyco_hydro_85	2.12e-06	33	65	259	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
pfam12799	LRR_4	3.71e-05	553	591	3	41	Leucine Rich repeats (2 copies). Leucine rich repeats are short sequence motifs present in a number of proteins with diverse functions and cellular locations. These repeats are usually involved in protein-protein interactions. Each Leucine Rich Repeat is composed of a beta-alpha unit. These units form elongated non-globular structures. Leucine Rich Repeats are often flanked by cysteine rich domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH30609.1	9.48e-188	4	516	437	958
SMF77083.1	1.13e-134	16	510	416	916
AMN36044.1	7.56e-116	14	509	412	906
QQZ59873.1	4.04e-115	16	512	424	925
AET57459.1	5.47e-115	17	509	412	910

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W91_A	1.37e-31	38	333	344	628	Structureof a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D. [Streptococcus pneumoniae TIGR4],2W92_A Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D, in complex with NAG-thiazoline. [Streptococcus pneumoniae TIGR4]
3GDB_A	3.76e-31	38	333	495	779	Crystalstructure of Spr0440 glycoside hydrolase domain, Endo-D from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6]
3FHA_A	2.67e-24	27	309	327	586	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHQ_A	2.67e-24	27	309	327	586	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
2VTF_A	4.80e-24	27	309	332	591	X-raycrystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997427	0.002489	0.000075	0.000008	0.000003	0.000021

TMHMM  Annotations     

start	end
1032	1054