CAZyme Information: MGYG000001588_00768

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000001588_00768
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414	MGYG000001588_25|CGC1	47220.45	4.8253

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001588	2411406	MAG	Canada	North America

• Gene Location: Start: 3635; End: 4879 Strand: -

Full Sequence      

MGGNQILDTYIEQLVRTSTPQEPAWNIEKIRAGKPNTWNYIDGCMIKALIELHEITGRED
YLTFADDYIDFFVHDDGTILHYDPYAYNLDNVNAGKTLYRLFELTGKQKYRRAMDTIYQQ
LETQPRTREGNFWHKKIYPNQVWLDGLYMAQPFYMQYELAFHNRRACSDSFHQFQVVHNV
MRCERNGLYYHAYDASRKQFWCDPVTGLSSNFWLRAEGWFAMALIDTWELMPASMSAEKD
GLREMFVELVDAMLPYQDAETGMWHQVINLPNIAPNYLEESGSAIFANAIMKGCRLGVLD
ESYYALGRRAFDGICTTCLHVRGGELALDNICLVAGLGNAAHREGTFEYYMREPVVSDDA
KGVAPLVLAYIETMRHDKLAGTCDPMSPAGCCSVEDPFDGYTPGINAQKDGAVA

Enzyme Prediction     

No EC number prediction in MGYG000001588_00768.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	34	375	7.8e-106	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	8.40e-78	31	375	26	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.73e-73	36	375	25	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG1331	YyaL	0.003	45	117	473	564	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP54720.1	1.82e-262	1	409	1	409
QIA34435.1	1.49e-261	1	409	1	409
QOL34305.1	1.24e-227	1	378	1	378
QOL31037.1	2.49e-227	1	378	1	378
QOV20148.1	9.39e-187	5	375	2	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.40e-86	38	372	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	4.49e-56	9	381	15	372	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.89e-55	9	381	5	362	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4XUV_A	2.15e-08	88	376	90	371	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.46e-55	9	381	15	372	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.60e-40	149	374	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.60e-40	149	374	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001588_00768.