CAZyme Information: MGYG000001570_00187

Basic Information

• Species: UBA4871 sp014467055
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA4871; UBA4871 sp014467055
• CAZyme ID: MGYG000001570_00187
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	MGYG000001570_19|CGC1	29271.22	5.4688

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001570	1608657	MAG	United States	North America

• Gene Location: Start: 6097; End: 6867 Strand: +

Full Sequence      

MALMECNFVSYSLEHGVDITITLPTLSSCDLEDKPCHTPPAKYPVLYLLHGKGNDYKSWL
RYTSIGRLAEEHQIAVVTFSCGNHFYLNCPNHENYFDFLEKELPEFISGNFPISNRPEDR
YIAGLSMGGYGTLIHALSCPEHYAAFGAFSSPIRVVNEEPTVPNAIDVFALLENLKQNGK
NMPQAYVACGKEDALFPDNLELHQAMTGQQLPHVWHAVPGYEHEWRFWNMEIEQFLSWLK
QDVRTDYYAKLPLHKI

Enzyme Prediction     

No EC number prediction in MGYG000001570_00187.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	38	239	1.5e-44	0.8898678414096917

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	2.12e-31	42	242	53	311	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	4.33e-21	37	228	18	235	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	1.70e-20	35	236	90	292	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PLN02442	PLN02442	2.58e-09	35	153	39	177	S-formylglutathione hydrolase
COG0596	MhpC	1.83e-04	44	244	22	214	Pimeloyl-ACP methyl ester carboxylesterase [Coenzyme transport and metabolism, General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV88191.1	2.37e-21	22	235	62	280
AEV69022.1	6.45e-21	12	245	40	284
QDU77222.1	1.14e-20	13	237	90	322
QNU68529.1	1.01e-19	9	243	35	280
AYB44329.1	1.03e-19	13	242	18	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	6.73e-40	1	239	2	261	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
7L0A_A	7.06e-32	1	242	9	261	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
6VH9_A	3.34e-31	2	242	4	255	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]
4ROT_A	6.05e-23	44	239	47	257	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
2UZ0_A	5.43e-19	2	246	6	259	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	3.29e-30	1	241	1	263	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
A7ZX03	1.55e-11	42	238	42	269	S-formylglutathione hydrolase FrmB OS=Escherichia coli O9:H4 (strain HS) OX=331112 GN=frmB PE=3 SV=1
B1LIP0	2.11e-11	42	238	42	269	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain SMS-3-5 / SECEC) OX=439855 GN=frmB PE=3 SV=1
Q0TKS8	2.11e-11	42	238	42	269	S-formylglutathione hydrolase FrmB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=frmB PE=3 SV=1
Q3Z551	2.11e-11	42	238	42	269	S-formylglutathione hydrolase FrmB OS=Shigella sonnei (strain Ss046) OX=300269 GN=frmB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001570_00187.