CAZyme Information: MGYG000001554_00259

Basic Information

• Species: Corynebacterium phoceense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium phoceense
• CAZyme ID: MGYG000001554_00259
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1619	MGYG000001554_1|CGC3	171398.95	4.266

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001554	2774100	Isolate	not provided	not provided

• Gene Location: Start: 268658; End: 273517 Strand: -

Full Sequence      

MTVEELRVWLRNWVVETTGVEPEEVTDTKPLENFGLSSRDAVVLSGELENLLGTHLDATV
AYEYPTIAQLADRLINGPADPQSLRSQAPAGGDAAPARKADEHDIAIIGMAGRFPGANDV
AEFWQMLTEYRTGTGPLPMGRWSEYTADPVISAKLETENTTGGYIEDIAGFDPEFFGLSP
LEATNMDPQQRIILELAWEALEDAGVPANELRGTATGVYIGSTNNDYGMLLAADPAEMHP
YALTGTSSAVIPNRVSYALDLRGPSINVDTACSTSLVAIHQAVRDLRTGAADAALAGGVN
ILAAPYASLGFSELGVISPTGNIHAFSDDADGIVRSDAAGLVVLKRLSDAQAAGDTILGV
IRGSAVNSDGHSNGITAPNPEAQVDVLRRAYADAGIDPRTVDYVEAHGTGTILGDPIEAS
ALGRVIGHGRDAASPMLLGSAKSNIGHSEAAAGVVGLIKVLSAMRANELPGQVNFTEPNH
YVDFDAEHLEVVADTREWPEYSGRKVAGVSGFGFGGTNAHLVLTDYRPDLDGETTRRPAQ
VRLEEKPAVDEDHPAVVPSFSLAVSGLLPSRRKALAAQLADFIEETHPDLFDVARVLAGR
NHARSRAVVTATNEEEAVRRLRQVAEGKVSVGISSADAPASSGPVFVYSGFGSQHRKMVK
DFLEVSPFFAERLAELDKIVDFESGWSILDIVRDDSQTYNTETGQVAVTAIQIALTDLLA
HFGARPSAVMGMSMGEIAAAYAAGGISAEDAMLIACHRARLMGEGEASLTEETQGAMAVV
ELSAEEIFALGNDIEPAVYAGPGMNTVGGPRQQVLDLVERLEGEGKFARALKVKGAGHTS
AVEPLLGELAAEIAGIEARPIHTALYSSVDKAVRYEPGATVHTDEYWLHMTRQAVYFQDA
TEQALAHGHTQLVEISPNPVALMGMMNTAFTVGKADAQLLYVFKRKIDESASLLDLLAKL
YVAGAPIDYRAVFGDLSAASANAAAPAVPHTQFKRQHLWTNARPASGVSGLPGARVTLPT
GQIAFGTNADQAPSVLALLESAAEAVEPGAQLAAVEEHADLPPAGDITVTVDRSLGGLSV
AAYLATDGSLLAEGFASTLQLSDAPTLQGVQAPSASTSAAPAADELADIEAVRWDPSQES
VEEHLALIVSESMGYDVSDLPRELPLIDLGLDSLMGMRIKNRVENDFQIPPIPVQALRDA
SLADVIAMVEEAVQTGETPSETPAAAGAAADAEDEAASESPAPQTSSEDAPAGAVDAEGV
GVAPRDASERLVFGTWATFTGKAAAGVTSTLPAISDEVAQQIAERLTERAGIEVTAGQVK
EAQTLEPLADRVREGLETEVEGNVRVLREADGPAVFMFHPAGGTTVVYQPLTRRLPDDVA
VYGIERVEGSIEERAESYLDDIITYARGRTIVLGGWSFGGALAYEVAAQLGKRRAAGEDV
PEVGFIALLDTTQPAHPAPDTLEETKARWGRYAAFAKKTYDLDFPVPYDLIETVGEDAVM
AMLAEFLSTTDASEHGLAAGVLEHQRASFVDNQILAKIDFQRWAEVDVPVLLFRSERMHD
GAIELEPAYAEIAPDGGWGQIVKNLEIVQLPGDHLAVPDEPAIGIVGKHMQQWIEEKLS

Enzyme Prediction     

No EC number prediction in MGYG000001554_00259.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3321	PksD	0.0	100	1056	1	931	Acyl transferase domain in polyketide synthase (PKS) enzymes [Secondary metabolites biosynthesis, transport and catabolism].
cd00833	PKS	0.0	104	523	2	421	polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations. PKSs can be divided into 2 groups, modular type I PKSs consisting of one or more large multifunctional proteins and iterative type II PKSs, complexes of several monofunctional subunits.
smart00825	PKS_KS	8.80e-137	105	523	1	296	Beta-ketoacyl synthase. The structure of beta-ketoacyl synthase is similar to that of the thiolase family and also chalcone synthase. The active site of beta-ketoacyl synthase is located between the N and C-terminal domains.
pfam00109	ketoacyl-synt	3.88e-78	105	350	1	249	Beta-ketoacyl synthase, N-terminal domain. The structure of beta-ketoacyl synthase is similar to that of the thiolase family (pfam00108) and also chalcone synthase. The active site of beta-ketoacyl synthase is located between the N and C-terminal domains. The N-terminal domain contains most of the structures involved in dimer formation and also the active site cysteine.
TIGR02813	omega_3_PfaA	1.82e-75	105	920	9	871	polyketide-type polyunsaturated fatty acid synthase PfaA. Members of the seed for this alignment are involved in omega-3 polyunsaturated fatty acid biosynthesis, such as the protein PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9. PfaA is encoded together with PfaB, PfaC, and PfaD, and the functions of the individual polypeptides have not yet been described. More distant homologs of PfaA, also included with the reach of this model, appear to be involved in polyketide-like biosynthetic mechanisms of polyunsaturated fatty acid biosynthesis, an alternative to the more familiar iterated mechanism of chain extension and desaturation, and in most cases are encoded near genes for homologs of PfaB, PfaC, and/or PfaD.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAZ00088.1	3.74e-107	44	917	1148	2015
BAZ75991.1	3.74e-107	44	917	1148	2015
BAY30132.1	1.55e-106	44	917	1150	2017
BAY90071.1	2.37e-102	44	917	1147	2014
AFY93865.1	8.54e-86	96	1050	952	1905

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BP1_A	4.05e-151	105	973	10	865	Condensingdi-domain (KS-AT) of a mycocerosic acid synthase-like (MAS-like) PKS [Mycolicibacterium smegmatis MC2 155]
7S6B_A	7.64e-146	100	1021	55	943	ChainA, Polyketide synthase [Streptomyces lasalocidi],7S6B_B Chain B, Polyketide synthase [Streptomyces lasalocidi]
2HG4_A	5.10e-145	105	999	41	898	Structureof the ketosynthase-acyltransferase didomain of module 5 from DEBS. [Saccharopolyspora erythraea],2HG4_B Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS. [Saccharopolyspora erythraea],2HG4_C Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS. [Saccharopolyspora erythraea],2HG4_D Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS. [Saccharopolyspora erythraea],2HG4_E Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS. [Saccharopolyspora erythraea],2HG4_F Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS. [Saccharopolyspora erythraea]
2QO3_A	1.23e-142	105	1006	8	889	CrystalStructure of [KS3][AT3] didomain from module 3 of 6-deoxyerthronolide B synthase [Saccharopolyspora erythraea],2QO3_B Crystal Structure of [KS3][AT3] didomain from module 3 of 6-deoxyerthronolide B synthase [Saccharopolyspora erythraea]
6C9U_A	1.22e-141	98	1006	27	915	Crystalstructure of [KS3][AT3] didomain from module 3 of 6-deoxyerthronolide B synthase in complex with antibody fragment (Fab) [Saccharopolyspora erythraea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I6X8D2	0.0	1	1612	18	1717	Polyketide synthase Pks13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pks13 PE=1 SV=1
P9WQE7	3.24e-184	5	928	10	912	Phenolphthiocerol/phthiocerol polyketide synthase subunit A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ppsA PE=1 SV=1
P9WQE6	3.24e-184	5	928	10	912	Phenolphthiocerol/phthiocerol polyketide synthase subunit A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=ppsA PE=3 SV=1
Q7TXM0	2.16e-182	5	928	10	912	Phenolphthiocerol/phthiocerol polyketide synthase subunit A OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=ppsA PE=1 SV=1
P9WQE4	1.19e-150	98	1022	29	931	Phenolphthiocerol/phthiocerol polyketide synthase subunit B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=ppsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001554_00259.