CAZyme Information: MGYG000001551_00042

Basic Information

• Species: Odoribacter massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter massiliensis
• CAZyme ID: MGYG000001551_00042
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		35901.17	8.5475

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001551	4400991	Isolate	not provided	not provided

• Gene Location: Start: 30523; End: 31470 Strand: -

Full Sequence      

MKKYTSLIYICTTVSILNIFAIVFYSQAAGGNSNLSAATPHTDLTPLEQALTVDVFVPEA
ISFAGEEVPLHRIDVQEALRKELIVNTYLHSHTLQLLKNAPRMFARIEPILKENGIPEDF
KYLAVIESNLNPSAVSPAGAVGLWQFLASTGEEAGLEINSEVDERYNVEKATQAASNYLK
KAYERFGSWTMAAAAYNAGNSMIQKQMDIQKEKNYYDLLLGEETERYVFRILALKQILNN
PNVYNFDPPTAYPIEKVKIVKIKKSVADWADFANKHDISYKTLKRFNPWLRKNKLKNPAH
REYEIRIPKDKEMYR

Enzyme Prediction     

No EC number prediction in MGYG000001551_00042.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	105	245	2e-26	0.9407407407407408

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.33e-59	111	236	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	2.72e-27	107	218	2	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	3.68e-26	75	250	80	256	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	4.40e-19	123	233	5	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.72e-16	107	233	10	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY32428.1	3.78e-142	1	315	1	311
SNV32652.1	3.78e-142	1	315	1	311
AZS32129.1	1.96e-117	54	315	47	308
QRO51442.1	1.60e-116	54	315	47	308
QGY43333.1	3.52e-103	19	308	18	301

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	5.21e-24	62	287	61	289	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	5.21e-24	62	287	61	289	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.809903	0.176174	0.006866	0.000953	0.000552	0.005560

TMHMM  Annotations     

start	end
7	29