CAZyme Information: MGYG000001546_01779

Basic Information

• Species: Alistipes provencensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes provencensis
• CAZyme ID: MGYG000001546_01779
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333	MGYG000001546_5|CGC28	38898.96	6.2617

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001546	3805103	Isolate	not provided	not provided

• Gene Location: Start: 2230715; End: 2231716 Strand: -

Full Sequence      

MKLWTPDTPVLYDLEATLLRGGKPVDRVGSYAAMRKNSTVRGKEGFLRLQLNDRECFQFG
PLDQGWWPDGLYTAPTDEALVYDIVKTKELGFNMIRKHVKVEPERWYWHCDRLGILVWQD
MPNGGPSPEWQNNRYFNGAEAERTARSEEQFRREWKEIIDQLYNHPSVVMWVPFNEAWGQ
FKTAEIARWTKDYDPTRIVNAASGGNFYPDAGEVLDIHSYPHPRFYLFDIGRVNVIGEYG
GIGLPLEGHLWQPDRNWGYVRFKNAGEVTDEYIRYAEMLERLIPTGCSGAVYTQTTDVEI
EVNGLMTYDRKRMKVDERRLREVNRRLCRSLGQ

Enzyme Prediction     

No EC number prediction in MGYG000001546_01779.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	9.42e-25	2	286	251	511	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	6.10e-11	80	311	38	285	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	2.72e-07	2	217	243	463	beta-D-glucuronidase; Provisional
pfam00703	Glyco_hydro_2	1.57e-06	2	35	73	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT62182.1	3.13e-176	1	332	271	602
QQA30640.1	3.13e-176	1	332	271	602
AVM58000.1	3.24e-176	1	331	274	603
ADY53599.1	3.57e-176	2	328	279	604
AVM52965.1	1.85e-175	1	331	274	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	9.50e-163	2	331	258	586	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
3FN9_A	1.47e-12	9	204	254	433	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5UJ6_A	5.11e-12	2	256	261	508	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D50_A	5.13e-12	2	256	269	516	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
6D8G_A	5.17e-11	2	256	269	516	D341AD367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM09	2.20e-11	2	204	272	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	6.57e-10	2	176	275	430	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
A7MN76	5.24e-09	3	205	310	500	Beta-galactosidase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=lacZ PE=3 SV=1
Q03WL0	1.23e-08	3	205	296	485	Beta-galactosidase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y) OX=203120 GN=lacZ PE=3 SV=1
I2C092	1.56e-08	3	185	262	438	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001546_01779.