CAZyme Information: MGYG000001542_04779

Basic Information

• Species: Paenibacillus_A sp900069005
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900069005
• CAZyme ID: MGYG000001542_04779
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000001542_44|CGC11	39225.45	4.7555

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001542	5846629	Isolate	not provided	not provided

• Gene Location: Start: 536448; End: 537503 Strand: -

Full Sequence      

MDKKSKFKQRAEHVFHRMIDVPADDWGMNIESWDWVPGVGVISILEYGQLTGDATAIEYL
QRWTERNKHKSEQVKVINSMAPYAIFPALYRMTGEQWYLDTATKIGDWMLTEAPRTRDGA
FEHTVTEDAQFSDQAWADTLFMAVVFLARLARLTGDSKYAKEAEFQLLVHLRLLQDPETG
VLFHGWNGSEGHHMSAARWARANAWVILAAPWIAAEIRDLIPLSDEIVKRYQQLAAGLRQ
YQRDSGLWSTVLDQSGFVEETSGSAGIAAGWLAGVRIGWLDAVYKEAAEKALQGVEEFIA
PDGTVEGVSGGTPVMPDIPSYHQIPCYPTLYGQGLVLILLSLAYTETGESL

Enzyme Prediction     

No EC number prediction in MGYG000001542_04779.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	29	341	2.8e-81	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	4.72e-67	32	346	33	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.63e-58	33	346	27	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
cd04792	LanM-like	2.19e-04	40	195	547	703	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
pfam07944	Glyco_hydro_127	5.07e-04	45	165	135	253	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG1331	YyaL	6.10e-04	88	164	479	561	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS18168.1	2.76e-233	18	351	1	334
SMF84348.1	2.04e-196	11	350	11	350
QTH40665.1	1.75e-142	6	343	9	346
CQR57726.1	1.88e-134	6	343	2	341
QGQ94179.1	1.75e-133	9	350	12	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	2.11e-55	32	341	65	375	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	1.84e-52	4	341	23	374	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	1.16e-51	32	340	46	365	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.72e-45	32	341	28	333	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	3.14e-06	142	291	1	158	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.14e-06	142	291	1	158	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001542_04779.