CAZyme Information: MGYG000001542_03247

Basic Information

• Species: Paenibacillus_A sp900069005
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900069005
• CAZyme ID: MGYG000001542_03247
• CAZy Family: PL12
• CAZyme Description: Heparin-sulfate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
724	MGYG000001542_37|CGC2	82694.87	5.0802

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001542	5846629	Isolate	not provided	not provided

• Gene Location: Start: 217948; End: 220122 Strand: +

Full Sequence      

MNVNGTEASHQDKVYSVFSLLQLEKPELADVAAAVKQDHYEEALQALHRYYLERHLPGNR
RSCEETAQITDYVKENWADEVAMVMKTADEVVNQTFLFQFPWDMERTQVPVTFDGAMDWN
CIPDVDPEWAYMLNRHRYWIALGQAYAMTGEDKYAAALCRQLEDWIDRNPVPSEPTRDTL
NWRTIEAGLRGSNWIKTLRYVWDSPLFTPVLLAKVLISLSEHARYLAEAFTGWKRISNWG
VLETNGLFPIALTFPELKGSEQWRSLAEERLGETARIQVMADGIHWEQSPTYHHEVMCCY
LDCLYLAEQHGIKLDEDFRGKVHEMAMASLYWANPGHRQPMFGDSDDNDVRSLLTYAAAL
FKDGTLRFGADQQMDYDSAWLLGMEAIRNYESLSSVEPAERSHAFIHSGHYVMRSGWSEQ
DLYMYFHCGPQGGGHGHADMLHIDLHAYGKEFLTDLGRYNYSDHTPVRQALKESAAHNTT
TVDDSGFTEIADTWMFDRIASPLGSKWISRPDYDYVEGSHDGYLRLDDPVLVNRRIIFIK
PHYWLLVDRFQSKGEHQYKQHFHFGSGAIGLEENSRICRTQNDGEANLLIIPIQSEGLHA
EVSESVISREYNLLESSPQLTYSRSGSGLTTMMQLLYPLRPGELAAPQVNKIPVFRHTGE
QVEDAQAEACRIVHPELGTEHILVISHKVPTGHYDSYVVDGVQIFGEIVLIAGSTDKRQI
TVIN

Enzyme Prediction     

No EC number prediction in MGYG000001542_03247.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL12	408	549	4.5e-42	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16889	Hepar_II_III_N	1.23e-55	18	363	1	338	Heparinase II/III N-terminus. This is the N-terminal domain of heparinase II/III proteins. It is a toroid-like domain.
pfam07940	Hepar_II_III	3.60e-30	398	631	2	230	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS15931.1	0.0	1	724	1	724
SMF90844.1	0.0	1	723	1	719
AIQ22723.1	0.0	1	724	1	720
AIQ73161.1	0.0	15	724	11	720
AIQ34533.1	0.0	9	724	5	719

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MMH_A	1.74e-46	18	638	10	595	Crystalstructure of heparan sulfate lyase HepC from Pedobacter heparinus [Pedobacter heparinus]
4MMI_A	1.74e-46	18	638	10	595	Crystalstructure of heparan sulfate lyase HepC mutant from Pedobacter heparinus [Pedobacter heparinus]
5JMD_A	5.08e-36	11	663	12	641	HeparinaseIII-BT4657 gene product, Methylated Lysines [Bacteroides thetaiotaomicron VPI-5482]
5JMF_A	4.03e-34	11	639	12	615	HeparinaseIII-BT4657 gene product [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59289	1.15e-45	18	638	34	619	Heparin-sulfate lyase OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=hepC PE=1 SV=1
C7EXL6	1.67e-35	7	663	19	652	Heparin-sulfate lyase OS=Bacteroides stercoris OX=46506 GN=hepC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001542_03247.