CAZyme Information: MGYG000001539_01427

Basic Information

• Species: Acutalibacter timonensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter timonensis
• CAZyme ID: MGYG000001539_01427
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
863	MGYG000001539_13|CGC4	99001.85	4.872

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001539	3671397	Isolate	not provided	not provided

• Gene Location: Start: 490985; End: 493576 Strand: -

Full Sequence      

MKKLNLAGEWRLRAEFLDVGPERVAEVAAKPDGPFTVYHGKSPNAFPAKTGFMRAQVPCD
VITPLVENGVIEEPLIKTNTKNCLWIRDLSWWFFKEFEVTEEMLQEDVIRLNIEMLDFKA
DIILNYRPMARHTNAFCPFCEDVKRFLKPGTNTLVIRLTSGIEDQYPKDAISFYCASDNA
ICDQRVYLRKPQFTYGWDWCQPVPTCGIGRAIYLEAFSGAKIISSRMDTCFLQDGNAEVE
FFFELDKTNMTASAEAVLEYELLFDGKPVYQGRQELLLVGGLNYAQEKVELQQAKLWWPN
GYGEQNLYELHARCTCMGNTVEDRVKKVGVRTVEIDHSKLSDGTRNFFFRVNGVRVFCKG
GNWVPTDSVYLRTPDSTYRTLVEEGKAAGFTMFRMWGGGTYEPDCFYEYCSECGILLMHD
FMYACGFYPDTLNSFLFEAQREADYQTKRLAHYPCMAVWTGNNEISESITDWFPEPIAPD
RFYGEKIFNYIQPSAVHQNSPRIPYMPSSPYFGGKANQVDDGDVHAWTYLGRDPKTKFKF
SYELEAFDRMPARFSSEYGFFGAQMESTVQRYHDGEEVVRGGEIWKHHGEFDRKRNGIDG
AINRHLTDFSKLDMQGYLLYSGIMQGCLYSEMSEAMRQKPYGAGDLIWMYNDCWPETGWT
VIDYYLTRKVSFYFLKRAFDTRKLIVRSREGGAVVTVINETPETVSAEIRYGYMKFTGEK
ACTGSKTLQVPAHSWQQFDFDGEGDLREGFFFASALESGFETADSLRAYYRDVAFPKAQV
KVDSVEKDGNDLMVTVSADAYVPVAYLKTSDDRVHYSDNYFKLYPGEKKTVRVLNCTEEP
VVYTAEMEPGERSAADEFQEASF

Enzyme Prediction     

No EC number prediction in MGYG000001539_01427.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	741	8.1e-72	0.6928191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	8.23e-38	85	830	59	781	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	8.16e-10	777	833	1	56	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	3.60e-09	234	331	13	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam18368	Ig_GlcNase	5.47e-07	776	833	19	84	Exo-beta-D-glucosaminidase Ig-fold domain. This domain can be found in 2 glycoside hydrolase subfamily of beta-glucosaminidases (EC:3.2.1.165) such as CsxA, from Amycolatopsis orientalis that has exo-beta-D-glucosaminidase (exo-chitosanase) activity. It has an immunoglobulin-like topology.
PRK10150	PRK10150	0.004	254	360	198	296	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97926.1	0.0	1	836	1	839
BBI35730.1	6.65e-188	35	838	23	830
QGQ95120.1	1.77e-186	52	831	33	824
QTH41537.1	5.95e-175	51	839	31	828
AEF81825.1	5.06e-172	3	833	2	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	2.97e-107	54	832	45	809	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.57e-96	52	831	25	814	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.64e-96	52	831	27	816	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.67e-96	52	831	27	816	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	4.30e-96	52	831	25	814	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	5.94e-76	57	687	32	661	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
A2QYN2	5.62e-75	57	687	32	661	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
Q0CCA0	1.44e-74	55	687	30	659	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
B8NW36	1.46e-74	57	843	32	839	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
Q2TXB7	2.01e-74	57	843	32	839	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001539_01427.