CAZyme Information: MGYG000001537_01427

Basic Information

• Species: Cellulomonas timonensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas timonensis
• CAZyme ID: MGYG000001537_01427
• CAZy Family: CE3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000001537_11|CGC9	38993.52	11.37

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001537	4057828	Isolate	not provided	not provided

• Gene Location: Start: 331545; End: 332630 Strand: +

Full Sequence      

MSGQPVVRRLAALIVLLLAGVAAIGVIAAAPRSEAATPVRVMALGDSITGSPGCWRALLW
QKLQQNGHTNVDMVGTLPAQGCGVAYDGDNEGHGGFLVTNVADQNQLVGWLAASTPDVVM
MHFGTNDVWSNRPTDQILAAYTKLVDQMRASNPNMKILVAKIIPVAPSTCAECPARTVAL
NNAIPGWAASKTTSASPITVVDQWTGWVPATDTYDGVHPSDPAGITKMANVWYPALTAVL
NGVSPTTPNPTAPDADPRRRLLCRPDPGQHLARRVRHRHPGHGRQQRRQRVAAHAHPAER
FRHQPVERPRDGLHRHGGHRRGGVERQVGGGRLHRPWVPGLRVGERRHRHLRGCLTARQP
G

Enzyme Prediction     

No EC number prediction in MGYG000001537_01427.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	39	236	1.4e-63	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01833	XynB_like	1.78e-59	39	236	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
pfam13472	Lipase_GDSL_2	3.09e-19	43	221	1	171	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd00229	SGNH_hydrolase	9.72e-18	41	235	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
pfam00657	Lipase_GDSL	7.38e-11	41	232	1	224	GDSL-like Lipase/Acylhydrolase.
cd01831	Endoglucanase_E_like	1.42e-09	116	237	56	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ77184.1	7.11e-116	4	252	3	246
AEE45464.1	1.64e-115	8	245	7	241
VEH29483.1	1.64e-115	8	245	7	241
BCB83596.1	7.78e-115	17	247	9	244
BCB78724.1	5.06e-114	30	247	28	244

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	7.50e-33	39	244	2	207	Crystalstructure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	2.05e-32	39	244	2	207	Crystalstructure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9RLB8	1.96e-14	21	253	25	278	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004905	0.994160	0.000244	0.000275	0.000181	0.000186

TMHMM  Annotations     

start	end
7	29