CAZyme Information: MGYG000001535_00856

Basic Information

• Species: Paenibacillus_A phocaensis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A phocaensis
• CAZyme ID: MGYG000001535_00856
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652	MGYG000001535_9|CGC6	70040.38	6.5025

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001535	5515101	Isolate	not provided	not provided

• Gene Location: Start: 260838; End: 262796 Strand: -

Full Sequence      

MLKKLRLLSLIGCMLVSILAIVPLTASAAGTVVSYPLPSIYTTTSQYTVTADSTHIPVID
TSEVFVNYNYCNFSFSGTTTITITASEPIHTYNISPKALEIPATKSGNTLTFTLSSPTYL
IVKINNLKDLVIAADALETNVPASSGTGIYNVKTGYGADSTGATLATTAIQNAINAANAA
GGGIVYVPAGVYKSGNLVLKSNVSVYLEGGSVIRGSGNPSDYTTHFHKNSLKKDGTWFIY
TETNANNIKIYGRGTIDGNGHYMRNTNNYLNNILVPLQCSNFTVDGITLRDSGGWATIVT
RSNNVTFQNTKHFNNNELDYENDAIDIQESQNVLIKHTVAVSEDDTYSFKTWDVATTDIA
ANWPGSPENQSNVVVDDALAWSRCGAFKVGDGVKQLQDGIVVKNSYVYRSWRALAVGHLY
GTPAAQNIIFDNIDVEGFWPRSGVHSRWFDLSAKTGPIKNVVYNNINLRALGEVSIMKGW
SDTSTVSGVTINNVRVGGVPATTLAELKITDTNSYAAAPKFNTLKFEAEGYNLSSGVIHY
EASTDGGLDVGGGSNGDYIAFKNVDFGSTAKTSIDLKVASANSGGRIEFHLDSPTGTMLG
YWTAESTGGWQKWSVKNIPLNAGTAVGTHTVYVTFVKSDSTTVANLTWFQFK

Enzyme Prediction     

No EC number prediction in MGYG000001535_00856.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	178	502	5.3e-45	0.9230769230769231
CBM6	527	652	4.9e-26	0.8623188405797102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04084	CBM6_xylanase-like	1.35e-34	525	651	2	123	Carbohydrate Binding Module 6 (CBM6); many are appended to glycoside hydrolase (GH) family 11 and GH43 xylanase domains. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family domains, including GH3, GH11, and GH43 domains. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB6s belonging to this family are Microbispora bispora GghA, a 1,4-beta-D-glucan glucohydrolase (GH3); Clostridium thermocellum xylanase U (GH11), and Penicillium purpurogenum ABF3, a bifunctional alpha-L-arabinofuranosidase/xylobiohydrolase (GH43). GH3 comprises enzymes with activities including beta-glucosidase (hydrolyzes beta-galactosidase) and beta-xylosidase (hydrolyzes 1,4-beta-D-xylosidase). GH11 family comprises enzymes with xylanase (endo-1,4-beta-xylanase) activity which catalyze the hydrolysis of beta-1,4 bonds of xylan, the major component of hemicelluloses, to generate xylooligosaccharides and xylose. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold.
smart00606	CBD_IV	1.84e-28	527	651	9	129	Cellulose Binding Domain Type IV.
pfam03422	CBM_6	2.47e-26	527	652	1	124	Carbohydrate binding module (family 6).
COG5434	Pgu1	4.51e-15	82	351	21	316	Polygalacturonase [Carbohydrate transport and metabolism].
cd04080	CBM6_cellulase-like	6.52e-11	530	652	29	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQZ61515.1	0.0	1	652	1	652
CQR58237.1	0.0	1	652	1	652
AWV34615.1	0.0	1	652	1	652
QUL57088.1	0.0	1	652	1	653
ACX65654.1	3.77e-137	25	514	54	555

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2V4V_A	1.26e-20	525	651	6	127	CrystalStructure of a Family 6 Carbohydrate-Binding Module from Clostridium cellulolyticum in complex with xylose [Ruminiclostridium cellulolyticum]
1W9S_A	1.87e-18	525	652	14	139	ChainA, Bh0236 Protein [Halalkalibacterium halodurans],1W9S_B Chain B, Bh0236 Protein [Halalkalibacterium halodurans],1W9T_A Chain A, Bh0236 Protein [Halalkalibacterium halodurans],1W9T_B Chain B, Bh0236 Protein [Halalkalibacterium halodurans],1W9W_A Chain A, Bh0236 Protein [Halalkalibacterium halodurans]
5M77_A	4.56e-17	525	651	392	522	ChainA, Alpha-1,6-mannanase [Niallia circulans],5M77_B Chain B, Alpha-1,6-mannanase [Niallia circulans]
1GMM_A	7.58e-14	525	635	6	115	ChainA, CBM6 [Acetivibrio thermocellus],1UXX_X Chain X, Xylanase U [Acetivibrio thermocellus]
5FUI_A	6.47e-13	522	624	9	111	Crystalstructure of the C-terminal CBM6 of LamC a marine laminarianse from Zobellia galactanivorans [Zobellia galactanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45796	3.25e-11	525	651	380	507	Arabinoxylan arabinofuranohydrolase OS=Paenibacillus polymyxa OX=1406 GN=xynD PE=1 SV=1
P10478	6.06e-10	518	651	293	419	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P15922	4.57e-09	154	552	155	597	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
Q45071	1.22e-08	514	651	368	510	Arabinoxylan arabinofuranohydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=xynD PE=1 SV=2
Q27082	1.34e-07	527	633	414	520	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000571	0.998371	0.000321	0.000264	0.000220	0.000211

TMHMM  Annotations     

start	end
7	29