CAZyme Information: MGYG000001534_00350

Basic Information

• Species: Xanthomonas_B massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Xanthomonas_B; Xanthomonas_B massiliensis
• CAZyme ID: MGYG000001534_00350
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	MGYG000001534_4|CGC1	41331.71	6.8412

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001534	3689702	Isolate	not provided	not provided

• Gene Location: Start: 104325; End: 105470 Strand: -

Full Sequence      

MFKRLRTVVAVAALTVATYAAATTAGEHPDTYVVRKGDTLWGIAGRFLGKPWLWPEIWQA
NPQVANPHLIYPGDVLSLAYLDRVAKGEIAPGPRQEAPIDAIPLAEVEPFLKNLSITDES
FRQLPYVVGLEDNRLRASAGQLAYVANLHDARPGQRYAVVRPTVRYAHPRPNEDLNADGS
LTPGSGNLWKSFMAPDERHELLGYELAQVNVGTIVPSVGEGLDSVSLRLEDSGREVRAGD
RIVPVQAHPYDLQFIPHPPSAQALAADGRVLAVADTFTSGGPRDVIALSVGARDGVDNGT
VFSLWNQSSYVNDRVGHHRFSRANAGYTAGSGTVKLPEEYAAHAMVFRTFDKVSYALVMK
GVKPVKVGYQGRSPDDAPLPQ

Enzyme Prediction     

No EC number prediction in MGYG000001534_00350.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1652	XkdP	5.97e-12	65	378	1	266	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
cd00118	LysM	1.14e-11	31	78	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
PRK11198	PRK11198	2.18e-09	32	76	98	143	LysM domain/BON superfamily protein; Provisional
TIGR02899	spore_safA	2.14e-08	34	73	1	37	spore coat assembly protein SafA. SafA (YrbB) (SafA) of Bacillus subtilis is a protein found at the interface of the spore cortex and spore coat, and is dependent on SpoVID for its localization. This model is based on the N-terminal LysM (lysin motif) domain (see pfamAM model pfam01476) of SafA and, from several other spore-forming species, the protein with the most similar N-terminal region. However, this set of proteins differs greatly in C-terminal of the LysM domaim; blocks of 12-residue and 13-residue repeats are found in the Bacillus cereus group, tandem LysM domains in Thermoanaerobacter tengcongensis MB4, etc. in which one of which is found in most examples of endospore-forming bacteria. [Cellular processes, Sporulation and germination]
COG1652	XkdP	3.89e-08	31	78	212	261	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJC47014.1	2.32e-190	1	375	1	375
QDI05556.1	5.34e-187	1	375	1	376
SMH63188.1	2.17e-186	1	375	1	376
QOF04941.1	2.17e-186	1	375	1	376
QXJ16869.1	2.17e-186	1	375	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6VE2_O	3.27e-51	28	374	27	341	ChainO, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_P Chain P, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_Q Chain Q, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_R Chain R, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_S Chain S, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_T Chain T, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_U Chain U, LysM domain-containing protein [Pseudomonas aeruginosa PAO1]
3JC8_Ta	3.25e-19	30	317	79	352	ChainTa, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tb Chain Tb, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tc Chain Tc, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Td Chain Td, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Te Chain Te, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tf Chain Tf, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tg Chain Tg, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Th Chain Th, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Ti Chain Ti, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tj Chain Tj, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tk Chain Tk, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tl Chain Tl, LysM domain protein [Myxococcus xanthus DK 1622],3JC9_Ta Chain Ta, TsaP [Myxococcus xanthus DK 1622],3JC9_Tb Chain Tb, TsaP [Myxococcus xanthus DK 1622],3JC9_Tc Chain Tc, TsaP [Myxococcus xanthus DK 1622],3JC9_Td Chain Td, TsaP [Myxococcus xanthus DK 1622],3JC9_Te Chain Te, TsaP [Myxococcus xanthus DK 1622],3JC9_Tf Chain Tf, TsaP [Myxococcus xanthus DK 1622],3JC9_Tg Chain Tg, TsaP [Myxococcus xanthus DK 1622],3JC9_Th Chain Th, TsaP [Myxococcus xanthus DK 1622],3JC9_Ti Chain Ti, TsaP [Myxococcus xanthus DK 1622],3JC9_Tj Chain Tj, TsaP [Myxococcus xanthus DK 1622],3JC9_Tk Chain Tk, TsaP [Myxococcus xanthus DK 1622],3JC9_Tl Chain Tl, TsaP [Myxococcus xanthus DK 1622]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54335	1.57e-07	29	78	158	217	Phage-like element PBSX protein XkdP OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdP PE=4 SV=2
P45932	1.72e-06	29	78	158	217	Uncharacterized protein YqbP OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbP PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000455	0.998720	0.000207	0.000218	0.000197	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001534_00350.