CAZyme Information: MGYG000001531_01715

Basic Information

• Species: Enterocloster sp001517625
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp001517625
• CAZyme ID: MGYG000001531_01715
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000001531_8|CGC2	42875.78	4.6539

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001531	3412690	Isolate	not provided	not provided

• Gene Location: Start: 168311; End: 169414 Strand: +

Full Sequence      

MKYTAADIDRYIDLYLNSFEKVLYEEDSQFMEGMKTRSLAGDDIRRYQFWEWTQGVGLYG
VWKLYKETKDERYMNILTSYYERQLKIGLPSKNVNTVTPLLAMSFVAEETDNERYMEVCR
EWAAWIYADFPRTKEGGLQHITSDTLNEGELWDDTLFMTVLFLANMGRILGEKKYQDEAE
YQFLLHIKYLTDRKTGLWYHGWSFKEKSHFAAAFWGRGNCWITAAIPEFLDLCPCSPSVE
KFLKETWKRQAEALIQYQEPTGMWHTLIDDKTSYVESSATCGFAYGILKGAELGLAETDW
VEAALKALEPIMEYTDETGVVNQVSYGTPMGRETKDFYKEIELKPMPYGQALAMLFFMEC
RKHISDF

Enzyme Prediction     

No EC number prediction in MGYG000001531_01715.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	48	360	1.3e-102	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.56e-101	24	359	12	348	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.46e-87	50	362	27	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR00386.1	4.09e-272	1	366	1	366
ANU44854.1	4.09e-272	1	366	1	366
QEH70918.1	5.44e-189	7	362	5	360
QOV18383.1	3.41e-176	2	362	5	365
BCJ96760.1	3.51e-176	1	359	2	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	2.40e-92	4	359	4	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	8.69e-92	43	355	58	371	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	8.08e-90	43	355	59	372	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
1NC5_A	3.31e-26	50	331	39	336	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.42e-25	50	331	29	326	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	2.93e-53	50	362	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	1.81e-25	50	331	39	336	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	4.07e-13	152	326	201	380	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001531_01715.