CAZyme Information: MGYG000001530_01486

Basic Information

• Species: Anaerococcus rubeinfantis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Anaerococcus; Anaerococcus rubeinfantis
• CAZyme ID: MGYG000001530_01486
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477	MGYG000001530_3|CGC9	56629.31	5.3755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001530	1928931	Isolate	not provided	not provided

• Gene Location: Start: 1329283; End: 1330716 Strand: -

Full Sequence      

MNRQTYINLEKENQEFRKKVNSDPNRLKFHLMPPTGFLNDPNGLYQKDGLYHIYFQYTPF
NPGWGLKTWGHYTSSDMLTFKEEEPFLYPDIKEDKDGVYSGSAFKEDGKVHFFYTGNVTY
KDMEGYDGVLVGREQNTIKVTSSDGFNYDKKNIILKNEDYPEFMSCHVRDPKIFKKDGNY
YMAIGGRMKDDVGCLLLFKSKDLENFEFFDMITPKEKFGYMWECPDLFELDGKLVLVTCP
QGVEKDGYKYENVYQCGYFFLDYDFETKKYSLSEFKELDHGFDVYAPQSFLDEKGRRIQY
TWMGIPDAEYTNEPTVKYGWNNALSMPKELKIKNNKLTQNPIEEMKKLRLKEYSCKIKEF
EGLNIKDELFEMKVNFERKEDFKLEIRKNVFLEYKKNLLTLTMNESGFGRDKRHIEIEEI
KNIRIFNDTSSIEIFINDGEEVITSRVYSEEISKPKFLTENKGKIQYYPLRGYEYIK

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	30	341	1.3e-91	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	1.03e-153	36	334	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	6.04e-149	14	448	2	443	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	2.10e-134	1	448	3	458	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	1.89e-109	30	439	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	4.49e-105	30	341	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SOB72997.1	1.44e-179	1	473	1	495
AVQ19049.1	2.84e-178	1	477	1	463
ALQ40753.1	3.51e-175	1	477	1	471
ALQ41936.1	9.33e-173	1	477	1	471
ALM94062.1	9.33e-173	1	477	1	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	2.59e-67	29	466	29	476	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NU7_A	1.42e-58	15	449	22	463	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	1.06e-56	18	450	40	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	1.51e-55	18	450	40	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	5.38e-47	29	472	6	429	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	2.95e-107	14	448	14	453	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q05936	9.27e-87	14	451	22	466	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P13394	2.01e-78	29	472	40	475	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
Q04937	2.70e-75	10	471	17	472	Sucrose-6-phosphate hydrolase OS=Lactococcus lactis subsp. lactis OX=1360 GN=scrB PE=1 SV=1
P27217	1.19e-70	22	448	23	438	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001530_01486.