CAZyme Information: MGYG000001525_03973

Basic Information

• Species: Paenibacillus_A rubinfantis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A rubinfantis
• CAZyme ID: MGYG000001525_03973
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	MGYG000001525_20|CGC9	29036.56	5.0587

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001525	5369528	Isolate	not provided	not provided

• Gene Location: Start: 479305; End: 480075 Strand: -

Full Sequence      

MNRQISNTSGHPHCGRVEIVEYDSTTVGTRRKVRVYTPPGFTRDQEYPVLYLLHGIGGDE
NEWFEHGEPHLILDRLYGDGKLMPMIVVMPNGRAMPEDRAEGDLFAPEKIQAFERFELDL
LHDLIPFVEANYPVKTERESRAIAGLSMGGGQTLNIGFSHLEHFAWIGAFSPAPNTKSPE
QLAPNPQETAARLSLLWLSCGEEDDLKYVSDRTRAYFSEQGIPHVWVEESGGHDWPVWRN
GLSEFSQRIFRSVRGE

Enzyme Prediction     

No EC number prediction in MGYG000001525_03973.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	24	246	6.3e-58	0.9647577092511013

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	9.59e-41	15	251	67	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	1.53e-27	24	244	1	241	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	2.71e-17	20	239	24	298	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2819	YbbA	1.17e-15	6	205	1	205	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
COG0400	YpfH	1.62e-09	48	236	19	191	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY75919.1	4.06e-132	15	251	18	254
AIQ57861.1	5.28e-127	15	250	17	252
AIQ29062.1	4.68e-125	15	250	25	260
AIQ40843.1	9.62e-123	15	250	17	252
AYB44329.1	4.99e-122	11	251	17	257

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JJF_A	4.58e-67	15	247	30	255	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	1.30e-66	15	247	30	255	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
6RZN_A	5.95e-45	12	251	128	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	2.31e-38	7	251	130	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	4.56e-35	12	251	113	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	2.30e-61	15	247	49	274	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	3.69e-35	15	251	429	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	3.09e-30	15	251	141	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	1.91e-27	15	251	498	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P51584	6.09e-10	12	167	824	974	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001525_03973.