CAZyme Information: MGYG000001525_03298

Basic Information

• Species: Paenibacillus_A rubinfantis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A rubinfantis
• CAZyme ID: MGYG000001525_03298
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
745	MGYG000001525_19|CGC15	83404.33	4.8705

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001525	5369528	Isolate	not provided	not provided

• Gene Location: Start: 1074734; End: 1076971 Strand: -

Full Sequence      

MGEYIDARESSSYWFGDEDGRILEVIAARYIGANPPIPFALRTFSKAGILQTAEGLYDMD
FAAKHPQAEDGDYAYAYGLVWSDGERSIDGVMEPLGPVRLFVNEQLTYLSTVVDELDPQA
RIQVPLELTPGWNTLLLEARKTASGFGCRFGADEAKVRILQVAAPFTDRQGSAGWVYSEP
VKTVCFGSDGKPFPDGQADEAASGLNWLPAVKWPEHLRGLPNLERIYGHPAQPAAAYAWS
TVHVPASAERIELNGSVRGATQIWVDDTLAVTVAGGGPFRIQTEVKPGIRQIVVRTENAK
EGWGFELAVEANGEPLAFFEPVKVHGNPSAWLYLAPLPVEEVLPPEQVRLVNKTFEGLIG
RVYWAVDAPELRVRPFYENAMLSNKWTTGGATNFGRWDYPLGVTMYGLLRTAKELNRPDI
RAYALSHISSCTEWYEYSLWDRVEYGFPAINHQLVLLRMLDNCGSFGSAMLQASLDGGEP
AESRKIADRISDFMLKRLERREDGAFYRRCEGEYSADTMWADDLYMSAPFLARYSEISGE
ADAINEAAKQFLRFKRYLYMSDQQIMSHVYDFKYGKPTRVPWGRGNGWVLFSLTELLERL
PEDHADREQLLTMFRELSEGIAALQSASGLWHQVLNRADAYLEASCTAMFVYAFSRGIRF
GWLDRKEPYAEAAIKGWRGLTAEAIDRQGNVHGVCSGSRYSFSPFYYMEDLRTVRNDNHG
IGIMMLAAVEVLQLKAALADSNITP

Enzyme Prediction     

No EC number prediction in MGYG000001525_03298.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	393	732	1.7e-88	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.89e-63	396	735	26	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.76e-46	395	734	32	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS26324.1	0.0	1	739	1	742
QKS43911.1	0.0	1	741	1	745
QYR20323.1	0.0	1	743	1	750
ANY74119.1	0.0	1	735	1	738
QOT11854.1	0.0	1	738	1	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	5.53e-38	453	734	137	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	1.37e-26	382	731	24	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.22e-26	382	731	14	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	8.10e-24	519	730	127	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
4CE7_A	2.88e-19	520	735	154	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	7.52e-26	382	731	24	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
L7P9J4	1.71e-18	520	735	161	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	4.39e-18	511	732	192	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	1.35e-15	397	738	29	342	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001525_03298.