CAZyme Information: MGYG000001523_02558

Basic Information

• Species: Gracilibacillus massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Gracilibacillus; Gracilibacillus massiliensis
• CAZyme ID: MGYG000001523_02558
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
758		87758.72	5.5544

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001523	4207224	Isolate	not provided	not provided

• Gene Location: Start: 47978; End: 50254 Strand: -

Full Sequence      

MGNIQLLEGLFHDSQQKGKDYLLYLDVDRLVAPCYEAVGVEAKKERYGGWESTPIAGHSI
GHWLSASATMYSVTGDTTLKEKLEYALSELESIQSIDHDGYLSGFPRDCFDQVFTGNFEV
SNFSLGGSWVPWYSIHKIYAGLIDVYQIIGSEKALEIVIRLSDWAYKGLKDLTEEQFQEM
LRCEHGGMNEVFADLYLITEDKRYLELAEKFYHNAVLDPLANKHDDLEGKHANTQIPKVI
GVAKLYNITGKEKYKQIATYFWDQVVHYRTYAIGGNSIREHFGPENAEELGILTTETCNT
YNMLKLTELLFDWQPHSYYFDYYERALYNHILASQDPDSGMKTYFVSTEPGHFKVYHSHD
HSFWCCTGTGMENPARYNRRIVEMKEDTLYVHLFISAKASFFDNRIKIKQLTDFPYQHSS
ALILEKVSDDLREIRIRKPNWLKNNSQVSVNGKPQNVEIENGYLVLKHDWQKGDEISFDL
SMELFRYYAKDDDKKQVIMYGPLVLAGALGRENFPNTDILADHQSLNNHPLIEVPTLVTE
EDLSNWIMLKDKEQLIFETNAIGQPGNQQVTLKPFFNIHHERYTIYWNIMSETRYQQVGD
EEKKRRAREQNVIIDEVTPHEQQPEVDHQLKEVNSFSGYSNDVHSGWRDARNGGYFSYVM
KVKSNHPMYLYVTYNKSDATIDVDGIKLEREFTISVDDHILAKEHFNQPNIGELYSKSYR
IPTQLIEGKEKVTVKFSADERKIAGGVYHLRVLNEPNL

Enzyme Prediction     

No EC number prediction in MGYG000001523_02558.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	4	506	2.1e-187	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	3	506	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.32e-170	4	595	12	581	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	2.53e-09	529	587	24	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH35421.1	0.0	1	758	1	758
QNF29693.1	0.0	1	755	1	756
APH66456.1	0.0	1	755	1	756
BAM47985.1	0.0	1	755	1	755
AEP88543.1	0.0	1	755	1	756

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.12e-153	3	753	32	801	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	8.63e-149	3	753	32	801	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	4.82e-24	133	534	143	568	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	7.73e-15	123	504	178	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.62e-13	123	504	178	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.19e-12	63	504	81	564	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001523_02558.