CAZyme Information: MGYG000001523_01155

Basic Information

• Species: Gracilibacillus massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Gracilibacillus; Gracilibacillus massiliensis
• CAZyme ID: MGYG000001523_01155
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1032	MGYG000001523_11|CGC8	119393.12	4.7257

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001523	4207224	Isolate	not provided	not provided

• Gene Location: Start: 415132; End: 418230 Strand: +

Full Sequence      

MFNKTKQTYTPPKNGYPEWNNNPEIFEWNRMPQHALAIPYQNREQALSYKNEKSPFVKSL
NGKWKFHFSKNPDGRIKDFYQNDFDVSKWEQINVPAHWQLEGYDYPQYVNTRYPWIEHEE
IEAPFAPTNYNPVGQYVTTFDLPDSWEEKPVILHFAGVEAAFYVWLNGELVGYSEDTFTP
AEFNLTPYLQKGENKLAVEVYRWADASWLEDQDFWRMSGIFRDVYAYALPDLHLYDHRIR
TSFDQNYQDASLEVQAHVLNYFQKSLPTSQLEIELLSADNKTVSKQTIELDLDQKESSTA
TITTNIKKPFQWSAENPYLYTVVMTLKGEDGQVFEVFATKVGFRQFEMIDNIMHINGKRI
VFKGVNRHEFTADKGRAVTEQDMIEDIVLMKKYNINAVRTSHYPNHPKWYDLCDQYGLYV
IDETNLETHGTWEYGQQNLEDSLPGSKPEWTENVLDRCKSMYERDKNHPSIIIWSLGNES
FGGDNFVKMHDYFAKEDPTRLVHYEGVFHYRPSDHASDMESTMYRSPQELEFYATQPGDK
KPYILCEYSHSMGNSTGNLDKYTKLFDQYPSLQGGFIWDWKDQALRHQTDDGTEFLAYGG
DFGESPHDGNFAGDGLIFADGSVSPKLLEVKACYRNIDFEEQDLEKGVFKIINKHLFQTL
EDYKLVWTVEENGEVIESGVQLLDAAPQKEQIVTLAYQNDKFDPSKEQVITLQIVYENLP
FWAKPDHEVAFEQFFIPAISKSNATKGTISVNEQSNAYQITGEDFSVSFDQTTCDLTSYL
VKGVELIKSPMVPNYWRAMTDNDRGAKVDEKSSEWRKASLERTLIDLHIEQLENIIVVEA
FYQLPTTSASMATIRYTIHASGKIEVENMLQPGKSLSDIPEIGMRFELADSFDRLEWYGK
GPHETYWDRQKSGKVAKHEGKVSEQLQPYLKPQESGNKSGVRWMKITDNQGNGIQITGDP
TIEVNALAYTPFELEEASHHYKLPVSDKVSVRVNGWQMGVGGDDSWGQQTHPEYRLFANQ
NYVYRFTLEGLS

Enzyme Prediction     

No EC number prediction in MGYG000001523_01155.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	43	913	4.5e-235	0.976063829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	0.0	46	910	1	801	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	0.0	22	1028	19	1024	beta-galactosidase.
PRK10340	ebgA	0.0	22	1028	6	997	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	1.61e-114	346	639	1	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	7.00e-102	761	1028	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH34007.1	0.0	1	1032	1	1032
SQI62103.1	0.0	1	1032	1	1041
QWI08561.1	0.0	6	1032	7	1042
AWI11241.1	0.0	2	1028	1	1038
SQI62145.1	0.0	6	1032	7	1042

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	3.36e-266	18	1027	3	976	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	3.47e-266	18	1027	4	977	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3DEC_A	1.58e-194	17	1001	5	969	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	2.54e-188	13	1028	4	998	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
3MUY_1	1.56e-186	18	1020	15	1013	Chain1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O52847	0.0	9	1031	10	1034	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q9K9C6	9.99e-309	19	1028	9	1011	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1
Q56307	1.90e-265	18	1027	4	977	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P24131	2.33e-262	18	919	9	894	Beta-galactosidase OS=Clostridium acetobutylicum OX=1488 GN=cbgA PE=2 SV=2
P23989	1.74e-256	21	1032	12	1026	Beta-galactosidase OS=Streptococcus thermophilus OX=1308 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001523_01155.